Gene Gene information from NCBI Gene database.
Entrez ID 51434
Gene name Anaphase promoting complex subunit 7
Gene symbol ANAPC7
Synonyms (NCBI Gene)
APC7FERBON
Chromosome 12
Chromosome location 12q24.11
Summary This gene encodes a tetratricopeptide repeat containing component of the anaphase promoting complex/cyclosome (APC/C), a large E3 ubiquitin ligase that controls cell cycle progression by targeting a number of cell cycle regulators such as B-type cyclins f
miRNA miRNA information provided by mirtarbase database.
237
miRTarBase ID miRNA Experiments Reference
MIRT022598 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT044330 hsa-miR-106b-5p CLASH 23622248
MIRT041625 hsa-miR-484 CLASH 23622248
MIRT039011 hsa-miR-766-3p CLASH 23622248
MIRT038814 hsa-miR-93-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
33
GO ID Ontology Definition Evidence Reference
GO:0000792 Component Heterochromatin IMP 34942119
GO:0005634 Component Nucleus IDA 18445686, 21241890
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005654 Component Nucleoplasm TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606949 17380 ENSG00000196510
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UJX3
Protein name Anaphase-promoting complex subunit 7 (APC7) (Cyclosome subunit 7)
Protein function Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle (PubMed:18485873). The APC/C complex acts by mediating ubiquit
PDB 3FFL , 4UI9 , 5A31 , 5G04 , 5G05 , 5KHR , 5KHU , 5L9T , 5L9U , 5LCW , 6Q6G , 6Q6H , 6TLJ , 6TM5 , 6TNT , 8PKP , 8TAR , 8TAU , 9GAW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13181 TPR_8 373 404 Tetratricopeptide repeat Repeat
PF13432 TPR_16 480 543 Family
Sequence
MDPGDAAILESSLRILYRLFESVLPPLPAALQSRMNVIDHVRDMAAAGLHSNVRLLSSLL
LTMSNNNPELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPST
GNSASTPQSQCLPSEIEVKYKMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYK
KAGQERPSVTSYKEVLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQTVPNLDWLSVWI
KAYAFVHTGDNSRAISTICSLEKKSLLRDNVDLLGSLADLYFRAGDNKNSVLKFEQAQML
DPYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALY
LGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLAS
NSIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALTQRPDYIKAVV
KKAELLSREQKYEDGIALLRNALANQSDCVLHRILGDFLVAVNEYQEAMDQYSIALSLDP
NDQ
KSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQWFGMQ
Sequence length 599
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Human T-cell leukemia virus 1 infection
  Inactivation of APC/C via direct inhibition of the APC/C complex
APC/C:Cdc20 mediated degradation of Cyclin B
Autodegradation of Cdh1 by Cdh1:APC/C
APC/C:Cdc20 mediated degradation of Securin
APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Cdc20:Phospho-APC/C mediated degradation of Cyclin A
Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase
Regulation of APC/C activators between G1/S and early anaphase
APC/C:Cdc20 mediated degradation of mitotic proteins
Phosphorylation of the APC/C
APC-Cdc20 mediated degradation of Nek2A
Separation of Sister Chromatids
Senescence-Associated Secretory Phenotype (SASP)
CDK-mediated phosphorylation and removal of Cdc6
Transcriptional Regulation by VENTX
Antigen processing: Ubiquitination & Proteasome degradation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BIPOLAR DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Ferguson-Bonni neurodevelopmental syndrome Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Breast Neoplasms Inhibit 15743504
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Associate 15743504
★☆☆☆☆
Found in Text Mining only
Carcinoma Ductal Breast Inhibit 15743504
★☆☆☆☆
Found in Text Mining only
Leukemia Myeloid Acute Stimulate 29969755
★☆☆☆☆
Found in Text Mining only
Neoplasms Associate 29969755
★☆☆☆☆
Found in Text Mining only