Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	51433
Gene name Gene Name - the full gene name approved by the HGNC.	Anaphase promoting complex subunit 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ANAPC5
Synonyms (NCBI Gene) Gene synonyms aliases	APC5
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q24.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a tetratricopeptide repeat-containing component of the anaphase promoting complex/cyclosome (APC/C), a large E3 ubiquitin ligase that controls cell cycle progression by targeting a number of cell cycle regulators such as B-type cyclins f

Show/Hide all(57)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022451	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT049952	hsa-miR-30a-5p	CLASH	23622248
MIRT048874	hsa-miR-93-5p	CLASH	23622248
MIRT047361	hsa-miR-34a-5p	CLASH	23622248
MIRT038955	hsa-miR-26b-3p	CLASH	23622248
MIRT036395	hsa-miR-1227-3p	CLASH	23622248
MIRT781062	hsa-miR-1321	CLIP-seq
MIRT781063	hsa-miR-185	CLIP-seq
MIRT781064	hsa-miR-3130-3p	CLIP-seq
MIRT781065	hsa-miR-3162-5p	CLIP-seq
MIRT781066	hsa-miR-3664-5p	CLIP-seq
MIRT781067	hsa-miR-4306	CLIP-seq
MIRT781068	hsa-miR-4644	CLIP-seq
MIRT781069	hsa-miR-4714-5p	CLIP-seq
MIRT781070	hsa-miR-4719	CLIP-seq
MIRT781071	hsa-miR-4729	CLIP-seq
MIRT781072	hsa-miR-4739	CLIP-seq
MIRT781073	hsa-miR-4756-5p	CLIP-seq
MIRT781074	hsa-miR-4793-3p	CLIP-seq
MIRT781075	hsa-miR-499-3p	CLIP-seq
MIRT781076	hsa-miR-499a-3p	CLIP-seq
MIRT781077	hsa-miR-597	CLIP-seq
MIRT1930532	hsa-miR-214	CLIP-seq
MIRT1930533	hsa-miR-2964a-5p	CLIP-seq
MIRT781064	hsa-miR-3130-3p	CLIP-seq
MIRT1930534	hsa-miR-3619-5p	CLIP-seq
MIRT781066	hsa-miR-3664-5p	CLIP-seq
MIRT1930535	hsa-miR-3909	CLIP-seq
MIRT1930536	hsa-miR-4530	CLIP-seq
MIRT1930537	hsa-miR-4690-3p	CLIP-seq
MIRT781069	hsa-miR-4714-5p	CLIP-seq
MIRT781074	hsa-miR-4793-3p	CLIP-seq
MIRT1930538	hsa-miR-761	CLIP-seq
MIRT781062	hsa-miR-1321	CLIP-seq
MIRT781063	hsa-miR-185	CLIP-seq
MIRT781065	hsa-miR-3162-5p	CLIP-seq
MIRT781067	hsa-miR-4306	CLIP-seq
MIRT781068	hsa-miR-4644	CLIP-seq
MIRT781070	hsa-miR-4719	CLIP-seq
MIRT781071	hsa-miR-4729	CLIP-seq
MIRT781072	hsa-miR-4739	CLIP-seq
MIRT781073	hsa-miR-4756-5p	CLIP-seq
MIRT781075	hsa-miR-499-3p	CLIP-seq
MIRT781076	hsa-miR-499a-3p	CLIP-seq
MIRT781062	hsa-miR-1321	CLIP-seq
MIRT781063	hsa-miR-185	CLIP-seq
MIRT781065	hsa-miR-3162-5p	CLIP-seq
MIRT781066	hsa-miR-3664-5p	CLIP-seq
MIRT781067	hsa-miR-4306	CLIP-seq
MIRT781068	hsa-miR-4644	CLIP-seq
MIRT781069	hsa-miR-4714-5p	CLIP-seq
MIRT781070	hsa-miR-4719	CLIP-seq
MIRT781071	hsa-miR-4729	CLIP-seq
MIRT781072	hsa-miR-4739	CLIP-seq
MIRT781073	hsa-miR-4756-5p	CLIP-seq
MIRT781075	hsa-miR-499-3p	CLIP-seq
MIRT781076	hsa-miR-499a-3p	CLIP-seq

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	IDA	18445686, 21241890
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005680	Component	Anaphase-promoting complex	IBA
GO:0005680	Component	Anaphase-promoting complex	IDA	16364912
GO:0005680	Component	Anaphase-promoting complex	IEA
GO:0005680	Component	Anaphase-promoting complex	IPI	27120157
GO:0005680	Component	Anaphase-promoting complex	NAS	27120157
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IDA	18445686
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	NAS	15678131
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019903	Function	Protein phosphatase binding	IPI	21241890
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IBA
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IDA	29033132
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	NAS	15678131
GO:0045842	Process	Positive regulation of mitotic metaphase/anaphase transition	IBA
GO:0051301	Process	Cell division	IEA
GO:0051445	Process	Regulation of meiotic cell cycle	NAS	15678131
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	29033132
GO:0070979	Process	Protein K11-linked ubiquitination	IBA
GO:0070979	Process	Protein K11-linked ubiquitination	IDA	18485873, 29033132
GO:0141198	Process	Protein branched polyubiquitination	IDA	29033132

MIM	HGNC	e!Ensembl
606948	15713	ENSG00000089053

Protein

UniProt ID

Q9UJX4

Protein name

Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5)

Protein function

Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle (PubMed:18485873). The APC/C complex acts by mediating ubiquit

PDB

4UI9 , 5A31 , 5G04 , 5G05 , 5KHR , 5KHU , 5L9T , 5L9U , 5LCW , 6Q6G , 6Q6H , 6TLJ , 6TM5 , 6TNT , 8PKP , 8TAR , 8TAU , 9GAW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12862	ANAPC5	254 → 354	Anaphase-promoting complex subunit 5	Family
PF12862	ANAPC5	398 → 495	Anaphase-promoting complex subunit 5	Family

Sequence

MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRL
NQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFS
GTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSR
DEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKEL
NNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSL
RYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVL
LEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDI
SIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQ
GCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNS
IEGVYRKAVVLQAQNQMSEAHKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIA
LPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQALSLLHMAIEPILADGAILDK
GRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARL
YHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL

Sequence length

755

Interactions

View interactions

	KEGG		Reactome
	Cell cycle Oocyte meiosis Ubiquitin mediated proteolysis IL-17 signaling pathway Progesterone-mediated oocyte maturation Human T-cell leukemia virus 1 infection		Inactivation of APC/C via direct inhibition of the APC/C complex APC/C:Cdc20 mediated degradation of Cyclin B Autodegradation of Cdh1 by Cdh1:APC/C APC/C:Cdc20 mediated degradation of Securin APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Cdc20:Phospho-APC/C mediated degradation of Cyclin A Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase Regulation of APC/C activators between G1/S and early anaphase APC/C:Cdc20 mediated degradation of mitotic proteins Phosphorylation of the APC/C APC-Cdc20 mediated degradation of Nek2A Separation of Sister Chromatids Senescence-Associated Secretory Phenotype (SASP) CDK-mediated phosphorylation and removal of Cdc6 Transcriptional Regulation by VENTX Antigen processing: Ubiquitination & Proteasome degradation

ANAPC5 (anaphase promoting complex subunit 5)