Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	51433
Gene name Gene Name - the full gene name approved by the HGNC.	Anaphase promoting complex subunit 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ANAPC5
Synonyms (NCBI Gene) Gene synonyms aliases	APC5
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q24.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a tetratricopeptide repeat-containing component of the anaphase promoting complex/cyclosome (APC/C), a large E3 ubiquitin ligase that controls cell cycle progression by targeting a number of cell cycle regulators such as B-type cyclins f

Show/Hide all(57)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022451	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT049952	hsa-miR-30a-5p	CLASH	23622248
MIRT048874	hsa-miR-93-5p	CLASH	23622248
MIRT047361	hsa-miR-34a-5p	CLASH	23622248
MIRT038955	hsa-miR-26b-3p	CLASH	23622248
MIRT036395	hsa-miR-1227-3p	CLASH	23622248
MIRT781062	hsa-miR-1321	CLIP-seq
MIRT781063	hsa-miR-185	CLIP-seq
MIRT781064	hsa-miR-3130-3p	CLIP-seq
MIRT781065	hsa-miR-3162-5p	CLIP-seq
MIRT781066	hsa-miR-3664-5p	CLIP-seq
MIRT781067	hsa-miR-4306	CLIP-seq
MIRT781068	hsa-miR-4644	CLIP-seq
MIRT781069	hsa-miR-4714-5p	CLIP-seq
MIRT781070	hsa-miR-4719	CLIP-seq
MIRT781071	hsa-miR-4729	CLIP-seq
MIRT781072	hsa-miR-4739	CLIP-seq
MIRT781073	hsa-miR-4756-5p	CLIP-seq
MIRT781074	hsa-miR-4793-3p	CLIP-seq
MIRT781075	hsa-miR-499-3p	CLIP-seq
MIRT781076	hsa-miR-499a-3p	CLIP-seq
MIRT781077	hsa-miR-597	CLIP-seq
MIRT1930532	hsa-miR-214	CLIP-seq
MIRT1930533	hsa-miR-2964a-5p	CLIP-seq
MIRT781064	hsa-miR-3130-3p	CLIP-seq
MIRT1930534	hsa-miR-3619-5p	CLIP-seq
MIRT781066	hsa-miR-3664-5p	CLIP-seq
MIRT1930535	hsa-miR-3909	CLIP-seq
MIRT1930536	hsa-miR-4530	CLIP-seq
MIRT1930537	hsa-miR-4690-3p	CLIP-seq
MIRT781069	hsa-miR-4714-5p	CLIP-seq
MIRT781074	hsa-miR-4793-3p	CLIP-seq
MIRT1930538	hsa-miR-761	CLIP-seq
MIRT781062	hsa-miR-1321	CLIP-seq
MIRT781063	hsa-miR-185	CLIP-seq
MIRT781065	hsa-miR-3162-5p	CLIP-seq
MIRT781067	hsa-miR-4306	CLIP-seq
MIRT781068	hsa-miR-4644	CLIP-seq
MIRT781070	hsa-miR-4719	CLIP-seq
MIRT781071	hsa-miR-4729	CLIP-seq
MIRT781072	hsa-miR-4739	CLIP-seq
MIRT781073	hsa-miR-4756-5p	CLIP-seq
MIRT781075	hsa-miR-499-3p	CLIP-seq
MIRT781076	hsa-miR-499a-3p	CLIP-seq
MIRT781062	hsa-miR-1321	CLIP-seq
MIRT781063	hsa-miR-185	CLIP-seq
MIRT781065	hsa-miR-3162-5p	CLIP-seq
MIRT781066	hsa-miR-3664-5p	CLIP-seq
MIRT781067	hsa-miR-4306	CLIP-seq
MIRT781068	hsa-miR-4644	CLIP-seq
MIRT781069	hsa-miR-4714-5p	CLIP-seq
MIRT781070	hsa-miR-4719	CLIP-seq
MIRT781071	hsa-miR-4729	CLIP-seq
MIRT781072	hsa-miR-4739	CLIP-seq
MIRT781073	hsa-miR-4756-5p	CLIP-seq
MIRT781075	hsa-miR-499-3p	CLIP-seq
MIRT781076	hsa-miR-499a-3p	CLIP-seq

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	IDA	18445686, 21241890
GO:0005654	Component	Nucleoplasm	TAS
GO:0005680	Component	Anaphase-promoting complex	IBA	21873635
GO:0005680	Component	Anaphase-promoting complex	IDA	16364912
GO:0005819	Component	Spindle	IDA	18445686
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	TAS
GO:0007049	Process	Cell cycle	IEA
GO:0019903	Function	Protein phosphatase binding	IPI	21241890
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	IBA	21873635
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0045842	Process	Positive regulation of mitotic metaphase/anaphase transition	IBA	21873635
GO:0051301	Process	Cell division	IEA
GO:0070979	Process	Protein K11-linked ubiquitination	IBA	21873635
GO:0070979	Process	Protein K11-linked ubiquitination	IDA	18485873
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS

MIM	HGNC	e!Ensembl
606948	15713	ENSG00000089053

Protein

UniProt ID

Q9UJX4

Protein name

Anaphase-promoting complex subunit 5 (APC5) (Cyclosome subunit 5)

Protein function

Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle (PubMed:18485873). The APC/C complex acts by mediating ubiquit

PDB

4UI9 , 5A31 , 5G04 , 5G05 , 5KHR , 5KHU , 5L9T , 5L9U , 5LCW , 6Q6G , 6Q6H , 6TLJ , 6TM5 , 6TNT , 8PKP , 8TAR , 8TAU , 9GAW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12862	ANAPC5	254 → 354	Anaphase-promoting complex subunit 5	Family
PF12862	ANAPC5	398 → 495	Anaphase-promoting complex subunit 5	Family

Sequence

MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMSRTGEGAVSLMERRRL
NQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFS
GTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSR
DEGERKMEKEELDVSVREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKEL
NNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSL
RYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVL
LEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDI
SIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQ
GCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNS
IEGVYRKAVVLQAQNQMSEAHKLLQKLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIA
LPMLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQALSLLHMAIEPILADGAILDK
GRAMFLVAKCQVASAASYDQPKKAEALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARL
YHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL

Sequence length

755

Interactions

View interactions

	KEGG		Reactome
	Cell cycle Oocyte meiosis Ubiquitin mediated proteolysis IL-17 signaling pathway Progesterone-mediated oocyte maturation Human T-cell leukemia virus 1 infection		Inactivation of APC/C via direct inhibition of the APC/C complex APC/C:Cdc20 mediated degradation of Cyclin B Autodegradation of Cdh1 by Cdh1:APC/C APC/C:Cdc20 mediated degradation of Securin APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 Cdc20:Phospho-APC/C mediated degradation of Cyclin A Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase Regulation of APC/C activators between G1/S and early anaphase APC/C:Cdc20 mediated degradation of mitotic proteins Phosphorylation of the APC/C APC-Cdc20 mediated degradation of Nek2A Separation of Sister Chromatids Senescence-Associated Secretory Phenotype (SASP) CDK-mediated phosphorylation and removal of Cdc6 Transcriptional Regulation by VENTX Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining
Colorectal Neoplasms	Associate	28731177
Non alcoholic Fatty Liver Disease	Associate	37993474

ANAPC5 (anaphase promoting complex subunit 5)