Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	51428
Gene name Gene Name - the full gene name approved by the HGNC.	DEAD-box helicase 41
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DDX41
Synonyms (NCBI Gene) Gene synonyms aliases	ABS, MPLPF
Disease Acronyms (UniProt) Disease acronyms from UniProt database	MPLPF
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q35.3
Summary Summary of gene provided in NCBI Entrez Gene.	DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and

Show/Hide all(15)

SNP ID	Visualize variation	Clinical significance	Consequence
rs141601766	C>T	Pathogenic, likely-pathogenic	5 prime UTR variant, initiator codon variant, missense variant
rs142143752	G>A	Risk-factor	Coding sequence variant, missense variant
rs200567842	C>A	Pathogenic	Coding sequence variant, 5 prime UTR variant, stop gained
rs376093707	G>A,T	Pathogenic	Coding sequence variant, missense variant
rs746278774	G>A	Likely-pathogenic	Stop gained, coding sequence variant, 5 prime UTR variant
rs747072227	A>G	Risk-factor	Coding sequence variant, missense variant
rs762890562	->CATC	Pathogenic	Coding sequence variant, stop gained, inframe indel
rs774698335	C>A,T	Likely-pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs780209663	C>A	Pathogenic	Coding sequence variant, missense variant
rs869320762	CT>TG	Risk-factor	Splice acceptor variant
rs1554111073	->T	Pathogenic	Coding sequence variant, frameshift variant
rs1554111533	C>T	Pathogenic	Splice acceptor variant
rs1554111653	T>-	Pathogenic	Coding sequence variant, 5 prime UTR variant, frameshift variant
rs1554111683	->TT	Pathogenic	Coding sequence variant, 5 prime UTR variant, frameshift variant
rs1581805747	->A	Pathogenic	Coding sequence variant, frameshift variant

Show/Hide all(40)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031540	hsa-miR-16-5p	Proteomics	18668040
MIRT032281	hsa-let-7b-5p	Proteomics	18668040
MIRT041875	hsa-miR-484	CLASH	23622248
MIRT930697	hsa-miR-1270	CLIP-seq
MIRT930698	hsa-miR-151-3p	CLIP-seq
MIRT930699	hsa-miR-185	CLIP-seq
MIRT930700	hsa-miR-2110	CLIP-seq
MIRT930701	hsa-miR-3144-5p	CLIP-seq
MIRT930702	hsa-miR-3150a-3p	CLIP-seq
MIRT930703	hsa-miR-3154	CLIP-seq
MIRT930704	hsa-miR-3191	CLIP-seq
MIRT930705	hsa-miR-3199	CLIP-seq
MIRT930706	hsa-miR-34a	CLIP-seq
MIRT930707	hsa-miR-34c-5p	CLIP-seq
MIRT930708	hsa-miR-4306	CLIP-seq
MIRT930709	hsa-miR-432	CLIP-seq
MIRT930710	hsa-miR-4456	CLIP-seq
MIRT930711	hsa-miR-4463	CLIP-seq
MIRT930712	hsa-miR-4499	CLIP-seq
MIRT930713	hsa-miR-449a	CLIP-seq
MIRT930714	hsa-miR-449b	CLIP-seq
MIRT930715	hsa-miR-4531	CLIP-seq
MIRT930716	hsa-miR-4644	CLIP-seq
MIRT930717	hsa-miR-4652-5p	CLIP-seq
MIRT930718	hsa-miR-4709-3p	CLIP-seq
MIRT930719	hsa-miR-4740-5p	CLIP-seq
MIRT930720	hsa-miR-4757-5p	CLIP-seq
MIRT930721	hsa-miR-620	CLIP-seq
MIRT930722	hsa-miR-635	CLIP-seq
MIRT930723	hsa-miR-7	CLIP-seq
MIRT1975460	hsa-miR-1915	CLIP-seq
MIRT1975461	hsa-miR-1972	CLIP-seq
MIRT1975462	hsa-miR-3136-3p	CLIP-seq
MIRT1975463	hsa-miR-4663	CLIP-seq
MIRT1975464	hsa-miR-4726-3p	CLIP-seq
MIRT1975465	hsa-miR-4778-5p	CLIP-seq
MIRT2514815	hsa-miR-4514	CLIP-seq
MIRT2514816	hsa-miR-4692	CLIP-seq
MIRT2514815	hsa-miR-4514	CLIP-seq
MIRT2514816	hsa-miR-4692	CLIP-seq

Show/Hide all(18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000398	Process	MRNA splicing, via spliceosome	IBA	21873635
GO:0000398	Process	MRNA splicing, via spliceosome	IC	11991638
GO:0000398	Process	MRNA splicing, via spliceosome	IMP	25920683
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IBA	21873635
GO:0003724	Function	RNA helicase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	22365833, 25416956, 26030138, 28514442, 32296183, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	26712909
GO:0005681	Component	Spliceosomal complex	IDA	25920683
GO:0005829	Component	Cytosol	TAS
GO:0006915	Process	Apoptotic process	TAS	10607561
GO:0008283	Process	Cell population proliferation	IMP	25920683
GO:0016020	Component	Membrane	HDA	19946888
GO:0030154	Process	Cell differentiation	IMP	25920683
GO:0032481	Process	Positive regulation of type I interferon production	TAS
GO:0046872	Function	Metal ion binding	IEA
GO:0071013	Component	Catalytic step 2 spliceosome	IDA	11991638

MIM	HGNC	e!Ensembl
608170	18674	ENSG00000183258

Protein

UniProt ID

Q9UJV9

Protein name

Probable ATP-dependent RNA helicase DDX41 (EC 3.6.4.13) (DEAD box protein 41) (DEAD box protein abstrakt homolog)

Protein function

Multifunctional protein that participates in many aspects of cellular RNA metabolism. Plays pivotal roles in innate immune sensing and hematopoietic homeostasis (PubMed:34473945). Recognizes foreign or self-nucleic acids generated during microbi

PDB

2P6N , 5GVR , 5GVS , 5H1Y , 8C6J

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00270	DEAD	205 → 385	DEAD/DEAH box helicase	Domain
PF00271	Helicase_C	419 → 527	Helicase conserved C-terminal domain	Family

Sequence

MEESEPERKRARTDEVPAGGSRSEAEDEDDEDYVPYVPLRQRRQLLLQKLLQRRRKGAAE
EEQQDSGSEPRGDEDDIPLGPQSNVSLLDQHQHLKEKAEARKESAKEKQLKEEEKILESV
AEGRALMSVKEMAKGITYDDPIKTSWTPPRYVLSMSEERHERVRKKYHILVEGDGIPPPI
KSFKEMKFPAAILRGLKKKGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVI
MFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQEDSSPLLRCALCIGG
MSVKEQMETIRHGVHMMVATPGRLMDLLQKKMVSLDICRYLALDEADRMIDMGFEGDIRT
IFSYFKGQRQTLLFSATMPKKIQNFAKSALVKPVTINVGRAGAASLDVIQEVEYVKEEAK
MVYLLECLQKTPPPVLIFAEKKADVDAIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFRE
GKKDVLVATDVASKGLDFPAIQHVINYDMPEEIENYVHRIGRTGRSGNTGIATTFINKAC
DESVLMDLKALLLEAKQKVPPVLQVLHCGDESMLDIGGERGCAFCGGLGHRITDCPKLEA
MQTKQVSNIGRKDYLAHSSMDF

Sequence length

622

Interactions

View interactions

	KEGG		Reactome
	Cytosolic DNA-sensing pathway		STING mediated induction of host immune responses Regulation of innate immune responses to cytosolic DNA IRF3-mediated induction of type I IFN

Show/Hide Causal Diseases (6)

Disease term	Disease name	dbSNP ID
Causal
Anemia	Refractory anemias	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966 View all (89 more)
Hematologic malignancy predisposition syndrome	DDX41-related hematologic malignancy predisposition syndrome	rs762890562, rs869320762, rs141601766, rs1554111073, rs774698335, rs1554111653, rs1554111683, rs746278774
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297
Lymphoma	Lymphoma	rs11540652, rs1592119138, rs1592123162, rs1599367044
Myelodysplasia	Myelodysplasia	rs141601766, rs1261178797
Myelodysplastic syndrome	MYELODYSPLASTIC SYNDROME	rs193303018, rs387906631, rs1576745225, rs373145711, rs752746786, rs377023736, rs373221034, rs1576749014, rs1600586587

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Asthma	Asthma	ClinVar
Acromesomelic dysplasia	acromesomelic dysplasia	GenCC

Show/Hide Text Mining Associations (40)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	11815632, 29037261
Ataxia Telangiectasia	Associate	37874914
Atypical Squamous Cells of the Cervix	Associate	33626862
Bone Marrow Diseases	Associate	33626862
Breast Neoplasms	Associate	32965163
Carcinogenesis	Associate	33650667
Carcinoma Hepatocellular	Associate	33006365
Cerebral Amyloid Angiopathy	Associate	29037261
Cognitive Dysfunction	Associate	40596075
Colitis Ulcerative	Associate	36165492
Colorectal Neoplasms	Associate	31240215
Common Variable Immunodeficiency	Associate	32047491
GATA2 Deficiency	Associate	26693794
Hematologic Diseases	Associate	31484648
Hematologic Neoplasms	Associate	26712909, 29365323, 33626862, 35671390, 37406166, 37874914
Hemorrhage	Inhibit	31240215
Inflammation	Associate	34916496
Leukemia	Associate	37591941
Leukemia B Cell	Associate	35246110
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	34784413
Leukemia Myeloid Acute	Associate	26693794, 26712909, 30926971, 30963592, 31484648, 32868804, 33626862, 34482403, 34644397, 34916496, 35246110, 35443031, 35671390, 36322930, 37450374 View all (4 more)
Leukemia Myelomonocytic Chronic	Associate	30963592, 37665752
Leukemia T Cell	Associate	34793200
Li Fraumeni Syndrome	Stimulate	29365323
Lymphoma	Associate	26712909
Lymphoma B Cell	Associate	35671390, 37874914
Lymphoma Follicular	Associate	26712909
Lymphoproliferative Disorders	Associate	34390506
Mesothelioma	Associate	37556141
Myelodysplastic Syndromes	Associate	26693794, 26712909, 30963592, 31484648, 33626862, 34644397, 35246110, 35443031, 35671390, 36322930, 36436542, 36989067, 37506341, 37665752, 37874914, 38597818, 40596075 View all (2 more)
Neoplasm Metastasis	Associate	29930723, 32965163
Neoplasms	Inhibit	26712909, 34916496
Neoplasms	Associate	30963592, 31240215, 31484648, 32047491, 32307695, 32965163, 33533142, 33626862, 33650667, 34390506, 34482403, 34644397, 35246110, 35671390, 36322930, 37665752, 37874914, 40596075 View all (3 more)
Neoplasms	Stimulate	37450374
Neoplasms Squamous Cell	Associate	33650667
Neoplastic Syndromes Hereditary	Associate	33626862
Nerve Degeneration	Associate	31097588
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	37874914
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	22237025
Syndrome	Associate	37406166

DDX41 (DEAD-box helicase 41)