Gene Gene information from NCBI Gene database.
Entrez ID 51397
Gene name COMM domain containing 10
Gene symbol COMMD10
Synonyms (NCBI Gene)
PTD002
Chromosome 5
Chromosome location 5q23.1
miRNA miRNA information provided by mirtarbase database.
139
miRTarBase ID miRNA Experiments Reference
MIRT031600 hsa-miR-16-5p Microarray 21199864
MIRT440913 ebv-miR-BART4-5p HITS-CLIP 22473208
MIRT440913 ebv-miR-BART4-5p HITS-CLIP 22473208
MIRT903306 hsa-miR-337-3p CLIP-seq
MIRT903307 hsa-miR-3667-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 15799966, 21778237, 23563313, 25355947, 26496610, 28514442, 32296183, 32814053, 33961781, 35271311, 37172566
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
616704 30201 ENSG00000145781
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y6G5
Protein name COMM domain-containing protein 10
Protein function Scaffold protein in the commander complex that is essential for endosomal recycling of transmembrane cargos; the commander complex is composed of the CCC subcomplex and the retriever subcomplex (PubMed:37172566, PubMed:38459129). May modulate ac
PDB 8ESD , 8F2R , 8F2U , 8P0W
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07258 COMM_domain 131 202 COMM domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:15799966}.
Sequence
MAVPAALILRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAA
FSLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQET
VEKFRQRILAPCKLETVGWQLNLQMAHSAQAKLKSPQAVLQLGVNNEDSKSLEKVLVEFS
HKELFDFYNKLETIQAQLDSLT
Sequence length 202
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neddylation