Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51397
Gene name Gene Name - the full gene name approved by the HGNC.
COMM domain containing 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
COMMD10
Synonyms (NCBI Gene) Gene synonyms aliases
PTD002
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q23.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT031600 hsa-miR-16-5p Microarray 21199864
MIRT440913 ebv-miR-BART4-5p HITS-CLIP 22473208
MIRT440913 ebv-miR-BART4-5p HITS-CLIP 22473208
MIRT903306 hsa-miR-337-3p CLIP-seq
MIRT903307 hsa-miR-3667-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 15799966, 21778237, 23563313, 25355947, 26496610, 28514442, 32296183, 32814053
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
616704 30201 ENSG00000145781
Protein
UniProt ID Q9Y6G5
Protein name COMM domain-containing protein 10
Protein function Scaffold protein in the commander complex that is essential for endosomal recycling of transmembrane cargos; the commander complex is composed of the CCC subcomplex and the retriever subcomplex (PubMed:37172566, PubMed:38459129). May modulate ac
PDB 8ESD , 8F2R , 8F2U , 8P0W
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07258 COMM_domain 131 202 COMM domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:15799966}.
Sequence
MAVPAALILRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAA
FSLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQET
VEKFRQRILAPCKLETVGWQLNLQMAHSAQAKLKSPQAVLQLGVNNEDSKSLEKVLVEFS
HKELFDFYNKLETIQAQLDSLT
Sequence length 202
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neddylation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
31164008
Unknown
Disease term Disease name Evidence References Source
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis GWAS
Neuroticism Neuroticism GWAS
Glioblastoma Glioblastoma CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587 GWAS, CBGDA
Leprosy Leprosy GWAS
Associations from Text Mining
Disease Name Relationship Type References
Asthma Associate 24993907
Carcinoma Hepatocellular Inhibit 34047468
Carcinoma Hepatocellular Associate 34493238
Inflammation Associate 24993907
Neoplasms Inhibit 34047468
Neoplasms Associate 34493238, 36919165
Peripheral Arterial Disease Associate 31388106
Pulmonary Disease Chronic Obstructive Associate 24993907
Stomach Neoplasms Associate 36919165