Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	51390
Gene name	Androgen induced 1
Gene symbol	AIG1
Synonyms (NCBI Gene)	AIG-1dJ95L4.1
Chromosome	6
Chromosome location	6q24.2

Show/Hide all (52)

miRTarBase ID	miRNA	Experiments	Reference
MIRT046391	hsa-miR-15b-5p	CLASH	23622248
MIRT717830	hsa-miR-3974	HITS-CLIP	19536157
MIRT717829	hsa-miR-3656	HITS-CLIP	19536157
MIRT717830	hsa-miR-3974	HITS-CLIP	19536157
MIRT717829	hsa-miR-3656	HITS-CLIP	19536157
MIRT441246	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT441246	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT717830	hsa-miR-3974	HITS-CLIP	19536157
MIRT717829	hsa-miR-3656	HITS-CLIP	19536157
MIRT717830	hsa-miR-3974	HITS-CLIP	19536157
MIRT717829	hsa-miR-3656	HITS-CLIP	19536157
MIRT774421	hsa-miR-23a	CLIP-seq
MIRT774422	hsa-miR-23b	CLIP-seq
MIRT774423	hsa-miR-23c	CLIP-seq
MIRT774424	hsa-miR-335	CLIP-seq
MIRT774425	hsa-miR-4717-3p	CLIP-seq
MIRT774426	hsa-miR-561	CLIP-seq
MIRT1928527	hsa-miR-4310	CLIP-seq
MIRT774426	hsa-miR-561	CLIP-seq
MIRT2169319	hsa-miR-4747-5p	CLIP-seq
MIRT2471881	hsa-miR-1266	CLIP-seq
MIRT2471882	hsa-miR-3127-3p	CLIP-seq
MIRT2471883	hsa-miR-3135	CLIP-seq
MIRT2471884	hsa-miR-365	CLIP-seq
MIRT2471885	hsa-miR-3664-3p	CLIP-seq
MIRT2471886	hsa-miR-4271	CLIP-seq
MIRT2471887	hsa-miR-4294	CLIP-seq
MIRT2471888	hsa-miR-4518	CLIP-seq
MIRT2471889	hsa-miR-4533	CLIP-seq
MIRT2471890	hsa-miR-4725-3p	CLIP-seq
MIRT2169319	hsa-miR-4747-5p	CLIP-seq
MIRT2471891	hsa-miR-491-3p	CLIP-seq
MIRT2471892	hsa-miR-494	CLIP-seq
MIRT2471893	hsa-miR-539	CLIP-seq
MIRT2471894	hsa-miR-642a	CLIP-seq
MIRT2471895	hsa-miR-924	CLIP-seq
MIRT2471881	hsa-miR-1266	CLIP-seq
MIRT2471882	hsa-miR-3127-3p	CLIP-seq
MIRT2471885	hsa-miR-3664-3p	CLIP-seq
MIRT2674785	hsa-miR-3907	CLIP-seq
MIRT2674786	hsa-miR-3913-3p	CLIP-seq
MIRT2471888	hsa-miR-4518	CLIP-seq
MIRT2674787	hsa-miR-4528	CLIP-seq
MIRT2674788	hsa-miR-489	CLIP-seq
MIRT2471891	hsa-miR-491-3p	CLIP-seq
MIRT2471892	hsa-miR-494	CLIP-seq
MIRT2674789	hsa-miR-520d-5p	CLIP-seq
MIRT2674790	hsa-miR-522	CLIP-seq
MIRT2674791	hsa-miR-524-5p	CLIP-seq
MIRT2471893	hsa-miR-539	CLIP-seq
MIRT2674792	hsa-miR-556-3p	CLIP-seq
MIRT2471894	hsa-miR-642a	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21988832, 32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0012505	Component	Endomembrane system	IBA
GO:0016020	Component	Membrane	IDA	27018888
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016787	Function	Hydrolase activity	IMP	27018888
GO:0042758	Process	Long-chain fatty acid catabolic process	IMP	27018888

MIM	HGNC	e!Ensembl
608514	21607	ENSG00000146416

Q9NVV5

Protein name

Androgen-induced gene 1 protein (AIG-1) (Fatty acid esters of hydroxy fatty acids hydrolase AIG1) (FAHFA hydrolase AIG1) (EC 3.1.-.-)

Protein function

Hydrolyzes bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), but not other major classes of lipids (PubMed:27018888). Show a preference for FAHFAs with branching distal from the carboxylate head group of the lipids (PubMed:27018888).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04750	Far-17a_AIG1	12 → 219	FAR-17a/AIG1-like protein	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in heart, ovary, testis, liver, and kidney, at lower levels in spleen, prostate, brain, skeletal muscle, pancreas, small intestine and colon, and undetected in peripheral blood leukocytes, thymus, lung and placenta. AI

Sequence

MALVPCQVLRMAILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLT
DLSSLLTRGSGNQEQERQLKKLISLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKL
LDNFIPGWLNHGMHTTVLPFILIEMRTSHHQYPSRSSGLTAICTFSVGYILWVCWVHHVT
GMWVYPFLEHIGPGARIIFFGSTTILMNFLYLLGEVLNNYIWDTQKSMEEEKEKPKLE

Sequence length

238

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATHEROSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Hepatocellular	Associate	34664394	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cell Transformation Neoplastic	Stimulate	25482449	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	21976542, 26758191	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Associate	23698072	★★★★★ ★☆☆☆☆ Found in Text Mining only

AIG1 (androgen induced 1)