Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5138
Gene name Gene Name - the full gene name approved by the HGNC.	Phosphodiesterase 2A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PDE2A
Synonyms (NCBI Gene) Gene synonyms aliases	CGS-PDE, IDDPADS, PDE2A1, PED2A4, cGSPDE
Disease Acronyms (UniProt) Disease acronyms from UniProt database	IDDPADS
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.4

Show/Hide all(42)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004169	hsa-miR-192-5p	Microarray	16822819
MIRT017522	hsa-miR-335-5p	Microarray	18185580
MIRT1220258	hsa-miR-103b	CLIP-seq
MIRT1220259	hsa-miR-298	CLIP-seq
MIRT1220260	hsa-miR-3151	CLIP-seq
MIRT1220261	hsa-miR-3675-5p	CLIP-seq
MIRT1220262	hsa-miR-3919	CLIP-seq
MIRT1220263	hsa-miR-4311	CLIP-seq
MIRT1220264	hsa-miR-4428	CLIP-seq
MIRT1220265	hsa-miR-4676-5p	CLIP-seq
MIRT1220266	hsa-miR-4786-3p	CLIP-seq
MIRT1220267	hsa-miR-486-3p	CLIP-seq
MIRT1220268	hsa-miR-494	CLIP-seq
MIRT1220269	hsa-miR-541	CLIP-seq
MIRT1220270	hsa-miR-543	CLIP-seq
MIRT1220271	hsa-miR-575	CLIP-seq
MIRT1220272	hsa-miR-587	CLIP-seq
MIRT1220273	hsa-miR-654-5p	CLIP-seq
MIRT1220258	hsa-miR-103b	CLIP-seq
MIRT2063610	hsa-miR-1266	CLIP-seq
MIRT2063611	hsa-miR-3199	CLIP-seq
MIRT2063612	hsa-miR-4518	CLIP-seq
MIRT2063613	hsa-miR-4731-5p	CLIP-seq
MIRT2063614	hsa-miR-510	CLIP-seq
MIRT2292084	hsa-miR-2467-3p	CLIP-seq
MIRT1220260	hsa-miR-3151	CLIP-seq
MIRT2292085	hsa-miR-3173-5p	CLIP-seq
MIRT1220261	hsa-miR-3675-5p	CLIP-seq
MIRT2292086	hsa-miR-3678-3p	CLIP-seq
MIRT1220264	hsa-miR-4428	CLIP-seq
MIRT2292087	hsa-miR-4685-5p	CLIP-seq
MIRT2292088	hsa-miR-4722-3p	CLIP-seq
MIRT2292089	hsa-miR-4755-3p	CLIP-seq
MIRT1220267	hsa-miR-486-3p	CLIP-seq
MIRT1220269	hsa-miR-541	CLIP-seq
MIRT1220273	hsa-miR-654-5p	CLIP-seq
MIRT2589693	hsa-miR-198	CLIP-seq
MIRT2589694	hsa-miR-377	CLIP-seq
MIRT2292087	hsa-miR-4685-5p	CLIP-seq
MIRT2589693	hsa-miR-198	CLIP-seq
MIRT2589694	hsa-miR-377	CLIP-seq
MIRT2292087	hsa-miR-4685-5p	CLIP-seq

Show/Hide all(66)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	17329248
GO:0000287	Function	Magnesium ion binding	IDA	15938621
GO:0003170	Process	Heart valve development	ISS
GO:0003281	Process	Ventricular septum development	ISS
GO:0004114	Function	3',5'-cyclic-nucleotide phosphodiesterase activity	IBA	21873635
GO:0004115	Function	3',5'-cyclic-AMP phosphodiesterase activity	IBA	21873635
GO:0004115	Function	3',5'-cyclic-AMP phosphodiesterase activity	IDA	15938621
GO:0004118	Function	CGMP-stimulated cyclic-nucleotide phosphodiesterase activity	IBA	21873635
GO:0004118	Function	CGMP-stimulated cyclic-nucleotide phosphodiesterase activity	IDA	17329248, 19689430
GO:0005515	Function	Protein binding	IPI	17329248
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	10375378
GO:0005737	Component	Cytoplasm	IDA	10375378, 19506089
GO:0005741	Component	Mitochondrial outer membrane	IBA	21873635
GO:0005741	Component	Mitochondrial outer membrane	IDA	28463107
GO:0005743	Component	Mitochondrial inner membrane	IBA	21873635
GO:0005743	Component	Mitochondrial inner membrane	IDA	28463107
GO:0005759	Component	Mitochondrial matrix	IBA	21873635
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005794	Component	Golgi apparatus	ISS
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA	17329248
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	19252089
GO:0005886	Component	Plasma membrane	IDA	17329248
GO:0007165	Process	Signal transduction	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	17329248
GO:0008270	Function	Zinc ion binding	IDA	15938621
GO:0010628	Process	Positive regulation of gene expression	IBA	21873635
GO:0010752	Process	Regulation of cGMP-mediated signaling	IMP	15938621
GO:0010754	Process	Negative regulation of cGMP-mediated signaling	IBA	21873635
GO:0010821	Process	Regulation of mitochondrion organization	IBA	21873635
GO:0019933	Process	CAMP-mediated signaling	IBA	21873635
GO:0019933	Process	CAMP-mediated signaling	IMP	17704206
GO:0019934	Process	CGMP-mediated signaling	IBA	21873635
GO:0019934	Process	CGMP-mediated signaling	IMP	17704206
GO:0030552	Function	CAMP binding	IMP	15938621
GO:0030553	Function	CGMP binding	IDA	17329248, 19689430, 19828435
GO:0030553	Function	CGMP binding	IMP	15938621
GO:0030911	Function	TPR domain binding	IPI	17329248
GO:0035904	Process	Aorta development	ISS
GO:0036006	Process	Cellular response to macrophage colony-stimulating factor stimulus	IDA	14687666
GO:0042301	Function	Phosphate ion binding	IDA	15938621
GO:0042734	Component	Presynaptic membrane	ISS
GO:0042803	Function	Protein homodimerization activity	IBA	21873635
GO:0042803	Function	Protein homodimerization activity	IPI	19828435
GO:0043116	Process	Negative regulation of vascular permeability	IMP	17704206
GO:0043117	Process	Positive regulation of vascular permeability	IMP	17704206
GO:0043949	Process	Regulation of cAMP-mediated signaling	IMP	15938621
GO:0043951	Process	Negative regulation of cAMP-mediated signaling	IBA	21873635
GO:0043951	Process	Negative regulation of cAMP-mediated signaling	IMP	19252089
GO:0046069	Process	CGMP catabolic process	IBA	21873635
GO:0046069	Process	CGMP catabolic process	IDA	19828435
GO:0047555	Function	3',5'-cyclic-GMP phosphodiesterase activity	IBA	21873635
GO:0047555	Function	3',5'-cyclic-GMP phosphodiesterase activity	IDA	15938621
GO:0048471	Component	Perinuclear region of cytoplasm	IBA	21873635
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	10375378
GO:0050729	Process	Positive regulation of inflammatory response	ISS
GO:0061028	Process	Establishment of endothelial barrier	ISS
GO:0071260	Process	Cellular response to mechanical stimulus	ISS
GO:0071320	Process	Cellular response to cAMP	IDA	17329248
GO:0071321	Process	Cellular response to cGMP	IDA	17704206, 19828435
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEP	17704206
GO:0097060	Component	Synaptic membrane	IBA	21873635
GO:1904613	Process	Cellular response to 2,3,7,8-tetrachlorodibenzodioxine	IDA	17329248

MIM	HGNC	e!Ensembl
602658	8777	ENSG00000186642

Protein

UniProt ID

O00408

Protein name

cGMP-dependent 3',5'-cyclic phosphodiesterase (EC 3.1.4.17) (Cyclic GMP-stimulated phosphodiesterase) (CGS-PDE) (cGSPDE)

Protein function

cGMP-activated cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes (PubMed:15938621, PubMed:29392776, PubMed:9210593). Has a high

PDB

1Z1L , 3IBJ , 3ITM , 3ITU , 4C1I , 4D08 , 4D09 , 4HTX , 4HTZ , 4JIB , 5TZ3 , 5TZA , 5TZC , 5TZH , 5TZW , 5TZX , 5TZZ , 5U00 , 5U7D , 5U7I , 5U7J , 5U7K , 5U7L , 5VP0 , 5VP1 , 5XKM , 6B96 , 6B97 , 6B98 , 6BLF , 6C7D , 6C7E , 6C7F , 6C7G , 6C7I , 6C7J , 6CYB , 6CYC , 6CYD , 6ZND , 6ZQZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01590	GAF	241 → 372	GAF domain	Domain
PF01590	GAF	409 → 548	GAF domain	Domain
PF00233	PDEase_I	655 → 889		Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed (PubMed:29392776, PubMed:9210593). Expressed in brain, with high expression observed in the corpus striatum (PubMed:29392776). Also expressed in heart, placenta, lung, skeletal muscle, kidney and pancreas (PubMed:29392

Sequence

MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPPQPCADSLQDALLSLGSVIDI
SGLQRAVKEALSAVLPRVETVYTYLLDGESQLVCEDPPHELPQEGKVREAIISQKRLGCN
GLGFSDLPGKPLARLVAPLAPDTQVLVMPLADKEAGAVAAVILVHCGQLSDNEEWSLQAV
EKHTLVALRRVQVLQQRGPREAPRAVQNPPEGTAEDQKGGAAYTDRDRKILQLCGELYDL
DASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGCLGQVV
EDKKSIQLKDLTSEDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLEGDLFTD
EDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITE
ARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPD
AYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAF
SIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNF
ASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMH
AFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYS
SEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDL
QKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAM
GNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSH
KFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDAE

Sequence length

941

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Metabolic pathways cGMP-PKG signaling pathway Olfactory transduction Aldosterone synthesis and secretion Morphine addiction		cGMP effects G alpha (s) signalling events

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	12972520
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	12972520
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465 View all (942 more)	12972520
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	22446963

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Convulsions And Choreoathetosis	infantile convulsions and choreoathetosis	GenCC
Insomnia	Insomnia	GWAS

Show/Hide Text Mining Associations (18)

Disease Name	Relationship Type	References
Associations from Text Mining
Abnormalities Drug Induced	Associate	32467598
Adrenal Hyperplasia Congenital	Associate	33112806
Arthritis Rheumatoid	Associate	23577190
Carcinoma Hepatocellular	Associate	35800238, 36054420, 37622118, 39699377
Carcinoma Hepatocellular	Inhibit	36611861
Cardiomyopathy Dilated	Associate	26095046
Chorea	Associate	32467598
Cognition Disorders	Associate	32467598
Coronary Artery Disease	Associate	26619243
Developmental Disabilities	Associate	32467598
Epilepsy	Associate	32467598
Melanoma	Associate	23381931
Mucocutaneous Lymph Node Syndrome	Associate	26619243
Neoplasm Metastasis	Associate	36611861
Neoplasms	Associate	36611861, 36981021, 39699377
Ovarian Diseases	Associate	39699377
Stomach Neoplasms	Associate	36981021, 39699377
Uterine Cervical Neoplasms	Associate	31804677

PDE2A (phosphodiesterase 2A)