SNX7 (sorting nexin 7)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51375
Gene name Gene Name - the full gene name approved by the HGNC.
Sorting nexin 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SNX7
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p21.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region like s
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(8)
miRTarBase ID miRNA Experiments Reference
MIRT021387 hsa-miR-9-5p Microarray 17612493
MIRT021836 hsa-miR-132-3p Microarray 17612493
MIRT022637 hsa-miR-124-3p Microarray 18668037
MIRT048715 hsa-miR-96-5p CLASH 23622248
MIRT043181 hsa-miR-324-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(18)
GO ID Ontology Definition Evidence Reference
GO:0000407 Component Phagophore assembly site IBA
GO:0000423 Process Mitophagy IBA
GO:0005515 Function Protein binding IPI 16189514, 23085988, 25416956, 28514442, 32296183, 32513819, 33961781, 35271311
GO:0005768 Component Endosome IEA
GO:0005769 Component Early endosome IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
614904 14971 ENSG00000162627
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9UNH6
Protein name Sorting nexin-7
Protein function Involved in the regulation of endocytosis and in several stages of intracellular trafficking (PubMed:32513819). Together with SNX4, involved in autophagosome assembly by regulating trafficking and recycling of phospholipid scramblase ATG9A (PubM
PDB 3IQ2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00787 PX 60 → 147 PX domain Domain
Sequence 
MDMNSFSPMMPTSPLSMINQIKFEDEPDLKDLFITVDEPESHVTTIETFITYRIITKTSR
GEFDSSEFEVRRRYQDFLWLKGKLEEAHPTLIIPPLPEKFIVKGMVERFNDDFIETRRKA
LHKFLNRIADHPTLTFNEDFKIFLTAQAWELSSHKKQGPGLLSRMGQTVRAVASSMRGVK
NRPEEFMEMNNFIELFSQKINLIDKISQRIYKEEREYFDEMKEYGPIHILWSASEEDLVD
TLKDVASCIDRCCKATEKRMSGLSEALLPVVHEYVLYSEMLMGVMKRRDQIQAELDSKVE
VLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQNDIKLAFTDMAEENIHYY
EQCLATWESFLTSQTNLHLEEASEDKP
Sequence length 387
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dementia Dementia N/A N/A GWAS
Dental caries Dental caries N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Show/Hide Text Mining Associations (5)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35635202
Attention Deficit Disorder with Hyperactivity Associate 26666201
Bipolar Disorder Associate 26666201
Carcinoma Hepatocellular Stimulate 37743471
Psychotic Disorders Associate 26666201