Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51363
Gene name Gene Name - the full gene name approved by the HGNC.
Carbohydrate sulfotransferase 15
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CHST15
Synonyms (NCBI Gene) Gene synonyms aliases
BRAG, GALNAC4S-6ST
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q26.13
Summary Summary of gene provided in NCBI Entrez Gene.
Chondroitin sulfate (CS) is a glycosaminoglycan which is an important structural component of the extracellular matrix and which links to proteins to form proteoglycans. Chondroitin sulfate E (CS-E) is an isomer of chondroitin sulfate in which the C-4 and
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT030113 hsa-miR-26b-5p Microarray 19088304
MIRT040371 hsa-miR-615-3p CLASH 23622248
MIRT610923 hsa-miR-8485 HITS-CLIP 19536157
MIRT610922 hsa-miR-329-3p HITS-CLIP 19536157
MIRT610921 hsa-miR-362-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0005515 Function Protein binding IPI 26496610, 28514442, 32296183
GO:0016021 Component Integral component of membrane NAS 11572857
GO:0019319 Process Hexose biosynthetic process IBA 21873635
GO:0019319 Process Hexose biosynthetic process IDA 11572857
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608277 18137 ENSG00000182022
Protein
UniProt ID Q7LFX5
Protein name Carbohydrate sulfotransferase 15 (EC 2.8.2.33) (B-cell RAG-associated gene protein) (hBRAG) (N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase) (GalNAc4S-6ST)
Protein function Sulfotransferase that transfers sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to the C-6 hydroxyl group of the GalNAc 4-sulfate residue of chondroitin sulfate A and forms chondroitin sulfate E containing GlcA-GalNAc(4,6-SO(4)) repeat
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13469 Sulfotransfer_3 254 503 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in B-cell-enriched tissues but not in fetal or adult thymus. Expressed in fetal and adult spleen, lymph node, tonsil, bone marrow and peripheral leukocytes. Not expressed in T-cells. In pro-B, pre-B, and mature B-cell lines,
Sequence
MRHCINCCIQLLPDGAHKQQVNCQGGPHHGHQACPTCKGENKILFRVDSKQMNLLAVLEV
RTEGNENWGGFLRFKKGKRCSLVFGLIIMTLVMASYILSGAHQELLISSPFHYGGFPSNP
SLMDSENPSDTKEHHHQSSVNNISYMKDYPSIKLIINSITTRIEFTTRQLPDLEDLKKQE
LHMFSVIPNKFLPNSKSPCWYEEFSGQNTTDPYLTNSYVLYSKRFRSTFDALRKAFWGHL
AHAHGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRL
RDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTF
FYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVT
EALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLSVFDKQQFLILRLED
HASNVKYTMHKVFQFLNLGPLSE
KQEALMTKSPASNARRPEDRNLGPMWPITQKILRDFY
RPFNARLAQVLADEAFAWKTT
Sequence length 561
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate   Chondroitin sulfate biosynthesis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Lung cancer Malignant neoplasm of lung rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135 27935865
Unknown
Disease term Disease name Evidence References Source
Glioblastoma Glioblastoma CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587 GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Astrocytoma Associate 23349846
Atrial Fibrillation Associate 37967346
Breast Neoplasms Associate 30963568
Carcinogenesis Associate 30963568
COVID 19 Associate 34185889
Epileptic Syndromes Associate 35798703
Esophageal Neoplasms Associate 31746400
Esophageal Squamous Cell Carcinoma Associate 31746400
Inflammation Associate 35798703
Kashin Beck Disease Associate 24857976, 28274888, 34151604