WT1-AS (WT1 antisense RNA)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 51352
Gene name WT1 antisense RNA
Gene symbol WT1-AS
Synonyms (NCBI Gene)
WIT-1WIT1WT1-AS1WT1AS
Chromosome 11
Chromosome location 11p13
Summary This gene is located upstream of the Wilms tumor 1 (WT1) gene; these two genes are bi-directionally transcribed from the same promoter region. This gene is imprinted in kidney, with preferential expression from the paternal allele. Imprinting defects at c
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Gene Gene ontology Other IDs Protein
Show/Hide all (1)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
607899 18135 ENSG00000183242
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q06250
Protein name Putative Wilms tumor upstream neighbor 1 gene protein (WIT-1) (Wilms tumor-associated antisense RNA)
Family and domains
Sequence 
MQRRGQPLENHVALIHWQSAGIPASKVHNYCNMKKSRLGRSRAVRISQPLLSPRRCPLHL
TERGAGLLQPQPQGPVRTPGPPSGSHPAAADN
Sequence length 92
Interactions View interactions