Gene Gene information from NCBI Gene database.
Entrez ID 51351
Gene name Zinc finger protein 117
Gene symbol ZNF117
Synonyms (NCBI Gene)
H-plkHPF9
Chromosome 7
Chromosome location 7q11.21
Summary This gene encodes a protein containing multiple C2H2-type zinc finger motifs. Readthrough transcription occurs between this gene and the upstream endogenous retrovirus group 3 member 1 (ERV3-1) locus, and may result in additional transcript variants encod
miRNA miRNA information provided by mirtarbase database.
993
miRTarBase ID miRNA Experiments Reference
MIRT437616 hsa-miR-146a-5p MicroarrayqRT-PCR 22815788
MIRT437622 hsa-miR-146b-5p MicroarrayqRT-PCR 22815788
MIRT518596 hsa-miR-581 HITS-CLIP 23313552
MIRT695757 hsa-miR-124-5p HITS-CLIP 23313552
MIRT518595 hsa-miR-578 HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity NAS 2023909
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
194624 12897 ENSG00000152926
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q03924
Protein name Zinc finger protein 117 (Provirus-linked krueppel) (h-PLK) (Zinc finger protein HPF9)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 165 187 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 193 215 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 221 243 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 249 271 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 277 299 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 305 327 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 333 355 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 361 383 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 417 439 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 445 467 Zinc finger, C2H2 type Domain
Sequence
MKRHEMVAKHLVMFYYFAQHLWPEQNIRDSFQKVTLRRYRKCGYENLQLRKGCKSVVECK
QHKGDYSGLNQCLKTTLSKIFQCNKYVEVFHKISNSNRHKMRHTENKHFKCKECRKTFCM
LSHLTQHKRIQTRVNFYKCEAYGRAFNWSSTLNKHKRIHTGEKPYKCKECGKAFNQTSHL
IRHKRIH
TEEKPYKCEECGKAFNQSSTLTTHNIIHTGEIPYKCEKCVRAFNQASKLTEHK
LIH
TGEKRYECEECGKAFNRSSKLTEHKYIHTGEKLYKCEECGKAFNQSSTLTTHKRIHS
GEKPYKCEECGKAFKQFSNLTDHKKIHTGEKPYKCEECGKAFNQLSNLTRHKVIHTGEKP
YKCGECGKAFNQSSALNTHKIIHTGENPHKCRESGKVFHLSSKLSTCKKIHTGEKLYKCE
ECGKAFNRSSTLIGHKRIH
TGEKPYKCEECGKAFNQSSTLTTHKIIHTEEKQYKCDECGK
AST
Sequence length 483
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Colorectal Neoplasms Associate 34573430
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Type 2 Associate 37816715
★☆☆☆☆
Found in Text Mining only
Glioblastoma Associate 35459228
★☆☆☆☆
Found in Text Mining only
Neoplasms Associate 34573430
★☆☆☆☆
Found in Text Mining only
Neoplasms Adipose Tissue Associate 37816715
★☆☆☆☆
Found in Text Mining only