Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51341
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger and BTB domain containing 7A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZBTB7A
Synonyms (NCBI Gene) Gene synonyms aliases
FBI-1, FBI1, LRF, MNDLFH, TIP21, ZBTB7, ZNF857A, pokemon
Disease Acronyms (UniProt) Disease acronyms from UniProt database
MNDLFH
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT048760 hsa-miR-93-5p CLASH 23622248
MIRT046756 hsa-miR-222-3p CLASH 23622248
MIRT438923 rno-miR-21-5p Luciferase reporter assay, qRT-PCR 23355454
MIRT438923 rno-miR-21-5p Luciferase reporter assay, qRT-PCR 23355454
MIRT438923 rno-miR-21-5p Luciferase reporter assay, qRT-PCR 23355454
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 20812024
GO:0000381 Process Regulation of alternative mRNA splicing, via spliceosome IDA 24514149
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IMP 26455326
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605878 18078 ENSG00000178951
Protein
UniProt ID O95365
Protein name Zinc finger and BTB domain-containing protein 7A (Factor binding IST protein 1) (FBI-1) (Factor that binds to inducer of short transcripts protein 1) (HIV-1 1st-binding protein 1) (Leukemia/lymphoma-related factor) (POZ and Krueppel erythroid myeloid onto
Protein function Transcription factor that represses the transcription of a wide range of genes involved in cell proliferation and differentiation (PubMed:14701838, PubMed:17595526, PubMed:20812024, PubMed:25514493, PubMed:26455326, PubMed:26816381). Directly an
PDB 2IF5 , 2NN2 , 7EYI , 7N5S , 7N5T , 7N5U , 7N5V , 7N5W , 8E3D , 8E3E , 8H9H
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00651 BTB 24 131 BTB/POZ domain Domain
PF00096 zf-C2H2 410 432 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 438 460 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed (PubMed:9927193). In normal thymus, expressed in medullary epithelial cells and Hassle's corpuscles (at protein level) (PubMed:15662416). In tonsil, expressed in squamous epithelium and germinal center lymphocytes (at
Sequence
MAGGVDGPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFK
KLFTSGAVVDQQNVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVS
HVCADLLDRQI
LAADAGADAGQLDLVDQIDQRNLLRAKEYLEFFQSNPMNSLPPAAAAAA
ASFPWSAFGASDDDLDATKEAVAAAVAAVAAGDCNGLDFYGPGPPAERPPTGDGDEGDSN
PGLWPERDEDAPTGGLFPPPVAPPAATQNGHYGRGGEEEAASLSEAAPEPGDSPGFLSGA
AEGEDGDGPDVDGLAASTLLQQMMSSVGRAGAAAGDSDEESRADDKGVMDYYLKYFSGAH
DGDVYPAWSQKVEKKIRAKAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFT
RQDKLKVHMRKH
TGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDH
LHRHLKKDGCNGVPSRRGRKPRVRGGAPDPSPGATATPGAPAQPSSPDARRNGQEKHFKD
EDEDEDVASPDGLGRLNVAGAGGGGDSGGGPGAATDGNFTAGLA
Sequence length 584
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Glioblastoma Glioblastoma, Glioblastoma Multiforme rs121913500, rs886042842, rs1555138291, rs1558518449, rs1567176006, rs1558650888 25875864
Leukemia Leukemia, Myelocytic, Acute, Acute Myeloid Leukemia (AML-M2) rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27798625
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 23727861
Unknown
Disease term Disease name Evidence References Source
Neurodevelopmental Disorders complex neurodevelopmental disorder GenCC
Lymphocytic Leukemia Lymphocytic Leukemia GWAS
Hypertension Hypertension GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 19244234, 33878706
Anemia Sickle Cell Associate 30285874, 40665149
Ascites Associate 21176152
Asthma Associate 39643224
Atherosclerosis Associate 24819318
Breast Neoplasms Associate 20471975, 20957096, 21392388, 21640721
Carcinogenesis Associate 21640721, 22754333, 23874836, 25192290, 28942243
Carcinoma Associate 21176152
Carcinoma Hepatocellular Associate 20471975, 21771706, 22754333, 26164003, 26227218
Carcinoma Hepatocellular Stimulate 23874836