PDCD1 (programmed cell death 1)

Gene

• Entrez ID: 5133
• Gene name: Programmed cell death 1
• Gene symbol: PDCD1
• Synonyms (NCBI Gene): ADMIO4, AIMTBS, CD279, PD-1, PD1, SLEB2, hPD-1, hPD-l, hSLE1
• Chromosome: 2
• Chromosome location: 2q37.3
• Summary: Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor expressed in activated T cells; it is involved in the regulation of T-cell functions, including those of effector CD8+ T cells. In addition, this protein can also promote the differe

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT542838	hsa-miR-497-5p	HITS-CLIP	22927820
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	22927820
MIRT542836	hsa-miR-424-5p	HITS-CLIP	22927820
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	22927820
MIRT542834	hsa-miR-195-5p	HITS-CLIP	22927820
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	22927820
MIRT542832	hsa-miR-16-5p	HITS-CLIP	22927820
MIRT542838	hsa-miR-497-5p	HITS-CLIP	22927820
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	22927820
MIRT542836	hsa-miR-424-5p	HITS-CLIP	22927820
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	22927820
MIRT542834	hsa-miR-195-5p	HITS-CLIP	22927820
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	22927820
MIRT542832	hsa-miR-16-5p	HITS-CLIP	22927820
MIRT542831	hsa-miR-4756-3p	HITS-CLIP	22927820
MIRT542830	hsa-miR-922	HITS-CLIP	22927820
MIRT542829	hsa-miR-4514	HITS-CLIP	22927820
MIRT542828	hsa-miR-4692	HITS-CLIP	22927820
MIRT542827	hsa-miR-6886-5p	HITS-CLIP	22927820
MIRT542838	hsa-miR-497-5p	HITS-CLIP	24906430
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	24906430
MIRT542836	hsa-miR-424-5p	HITS-CLIP	24906430
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	24906430
MIRT542834	hsa-miR-195-5p	HITS-CLIP	24906430
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	24906430
MIRT542832	hsa-miR-16-5p	HITS-CLIP	24906430
MIRT542838	hsa-miR-497-5p	HITS-CLIP	24906430
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	24906430
MIRT542836	hsa-miR-424-5p	HITS-CLIP	24906430
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	24906430
MIRT542834	hsa-miR-195-5p	HITS-CLIP	24906430
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	24906430
MIRT542832	hsa-miR-16-5p	HITS-CLIP	24906430
MIRT542831	hsa-miR-4756-3p	HITS-CLIP	24906430
MIRT542830	hsa-miR-922	HITS-CLIP	24906430
MIRT542829	hsa-miR-4514	HITS-CLIP	24906430
MIRT542828	hsa-miR-4692	HITS-CLIP	24906430
MIRT542838	hsa-miR-497-5p	HITS-CLIP	24906430
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	24906430
MIRT542836	hsa-miR-424-5p	HITS-CLIP	24906430
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	24906430
MIRT542834	hsa-miR-195-5p	HITS-CLIP	24906430
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	24906430
MIRT542832	hsa-miR-16-5p	HITS-CLIP	24906430
MIRT542838	hsa-miR-497-5p	HITS-CLIP	24906430
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	24906430
MIRT542836	hsa-miR-424-5p	HITS-CLIP	24906430
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	24906430
MIRT542834	hsa-miR-195-5p	HITS-CLIP	24906430
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	24906430
MIRT542832	hsa-miR-16-5p	HITS-CLIP	24906430
MIRT542831	hsa-miR-4756-3p	HITS-CLIP	24906430
MIRT542830	hsa-miR-922	HITS-CLIP	24906430
MIRT542829	hsa-miR-4514	HITS-CLIP	24906430
MIRT542828	hsa-miR-4692	HITS-CLIP	24906430
MIRT542827	hsa-miR-6886-5p	HITS-CLIP	24906430
MIRT542838	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT542836	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT542834	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT542832	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT542838	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT542836	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT542834	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT542832	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT542831	hsa-miR-4756-3p	PAR-CLIP	21572407
MIRT542830	hsa-miR-922	PAR-CLIP	21572407
MIRT542829	hsa-miR-4514	PAR-CLIP	21572407
MIRT542828	hsa-miR-4692	PAR-CLIP	21572407
MIRT542838	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT542836	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT542834	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT542832	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT542838	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT542836	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT542834	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT542832	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT542831	hsa-miR-4756-3p	PAR-CLIP	21572407
MIRT542830	hsa-miR-922	PAR-CLIP	21572407
MIRT542829	hsa-miR-4514	PAR-CLIP	21572407
MIRT542828	hsa-miR-4692	PAR-CLIP	21572407
MIRT542827	hsa-miR-6886-5p	PAR-CLIP	21572407
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	27292025
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	27292025
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	27292025
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	27292025
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	27292025
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	27292025
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	27292025
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	27292025
MIRT542832	hsa-miR-16-5p	PAR-CLIP	27292025
MIRT542832	hsa-miR-16-5p	PAR-CLIP	27292025
MIRT542832	hsa-miR-16-5p	PAR-CLIP	27292025
MIRT542832	hsa-miR-16-5p	PAR-CLIP	27292025
MIRT542834	hsa-miR-195-5p	PAR-CLIP	27292025
MIRT542834	hsa-miR-195-5p	PAR-CLIP	27292025
MIRT542834	hsa-miR-195-5p	PAR-CLIP	27292025
MIRT542834	hsa-miR-195-5p	PAR-CLIP	27292025
MIRT542836	hsa-miR-424-5p	PAR-CLIP	27292025
MIRT542836	hsa-miR-424-5p	PAR-CLIP	27292025
MIRT542836	hsa-miR-424-5p	PAR-CLIP	27292025
MIRT542836	hsa-miR-424-5p	PAR-CLIP	27292025
MIRT542829	hsa-miR-4514	PAR-CLIP	27292025
MIRT542829	hsa-miR-4514	PAR-CLIP	27292025
MIRT542829	hsa-miR-4514	PAR-CLIP	27292025
MIRT542828	hsa-miR-4692	PAR-CLIP	27292025
MIRT542828	hsa-miR-4692	PAR-CLIP	27292025
MIRT542828	hsa-miR-4692	PAR-CLIP	27292025
MIRT542831	hsa-miR-4756-3p	PAR-CLIP	27292025
MIRT542831	hsa-miR-4756-3p	PAR-CLIP	27292025
MIRT542831	hsa-miR-4756-3p	PAR-CLIP	27292025
MIRT542831	hsa-miR-4756-3p	PAR-CLIP	27292025
MIRT542838	hsa-miR-497-5p	PAR-CLIP	27292025
MIRT542838	hsa-miR-497-5p	PAR-CLIP	27292025
MIRT542838	hsa-miR-497-5p	PAR-CLIP	27292025
MIRT542838	hsa-miR-497-5p	PAR-CLIP	27292025
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	27292025
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	27292025
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	27292025
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	27292025
MIRT542827	hsa-miR-6886-5p	PAR-CLIP	27292025
MIRT542830	hsa-miR-922	PAR-CLIP	27292025
MIRT542830	hsa-miR-922	PAR-CLIP	27292025
MIRT542830	hsa-miR-922	PAR-CLIP	27292025
MIRT542830	hsa-miR-922	PAR-CLIP	27292025
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	27418678
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	27418678
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	27418678
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	27418678
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	27418678
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	27418678
MIRT542832	hsa-miR-16-5p	HITS-CLIP	27418678
MIRT542832	hsa-miR-16-5p	HITS-CLIP	27418678
MIRT542832	hsa-miR-16-5p	HITS-CLIP	27418678
MIRT542834	hsa-miR-195-5p	HITS-CLIP	27418678
MIRT542834	hsa-miR-195-5p	HITS-CLIP	27418678
MIRT542834	hsa-miR-195-5p	HITS-CLIP	27418678
MIRT542836	hsa-miR-424-5p	HITS-CLIP	27418678
MIRT542836	hsa-miR-424-5p	HITS-CLIP	27418678
MIRT542836	hsa-miR-424-5p	HITS-CLIP	27418678
MIRT542829	hsa-miR-4514	HITS-CLIP	27418678
MIRT542829	hsa-miR-4514	HITS-CLIP	27418678
MIRT542829	hsa-miR-4514	HITS-CLIP	27418678
MIRT542828	hsa-miR-4692	HITS-CLIP	27418678
MIRT542828	hsa-miR-4692	HITS-CLIP	27418678
MIRT542828	hsa-miR-4692	HITS-CLIP	27418678
MIRT542831	hsa-miR-4756-3p	HITS-CLIP	27418678
MIRT542831	hsa-miR-4756-3p	HITS-CLIP	27418678
MIRT542831	hsa-miR-4756-3p	HITS-CLIP	27418678
MIRT542838	hsa-miR-497-5p	HITS-CLIP	27418678
MIRT542838	hsa-miR-497-5p	HITS-CLIP	27418678
MIRT542838	hsa-miR-497-5p	HITS-CLIP	27418678
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	27418678
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	27418678
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	27418678
MIRT542827	hsa-miR-6886-5p	HITS-CLIP	27418678
MIRT542827	hsa-miR-6886-5p	HITS-CLIP	27418678
MIRT542827	hsa-miR-6886-5p	HITS-CLIP	27418678
MIRT542830	hsa-miR-922	HITS-CLIP	27418678
MIRT542830	hsa-miR-922	HITS-CLIP	27418678
MIRT542830	hsa-miR-922	HITS-CLIP	27418678
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	28735896
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	28735896
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	28735896
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	28735896
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	28735896
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	28735896
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	28735896
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	28735896
MIRT542832	hsa-miR-16-5p	HITS-CLIP	28735896
MIRT542832	hsa-miR-16-5p	HITS-CLIP	28735896
MIRT542832	hsa-miR-16-5p	HITS-CLIP	28735896
MIRT542832	hsa-miR-16-5p	HITS-CLIP	28735896
MIRT542834	hsa-miR-195-5p	HITS-CLIP	28735896
MIRT542834	hsa-miR-195-5p	HITS-CLIP	28735896
MIRT542834	hsa-miR-195-5p	HITS-CLIP	28735896
MIRT542834	hsa-miR-195-5p	HITS-CLIP	28735896
MIRT542836	hsa-miR-424-5p	HITS-CLIP	28735896
MIRT542836	hsa-miR-424-5p	HITS-CLIP	28735896
MIRT542836	hsa-miR-424-5p	HITS-CLIP	28735896
MIRT542836	hsa-miR-424-5p	HITS-CLIP	28735896
MIRT542829	hsa-miR-4514	HITS-CLIP	28735896
MIRT542829	hsa-miR-4514	HITS-CLIP	28735896
MIRT542829	hsa-miR-4514	HITS-CLIP	28735896
MIRT542828	hsa-miR-4692	HITS-CLIP	28735896
MIRT542828	hsa-miR-4692	HITS-CLIP	28735896
MIRT542828	hsa-miR-4692	HITS-CLIP	28735896
MIRT542831	hsa-miR-4756-3p	HITS-CLIP	28735896
MIRT542831	hsa-miR-4756-3p	HITS-CLIP	28735896
MIRT542831	hsa-miR-4756-3p	HITS-CLIP	28735896
MIRT542831	hsa-miR-4756-3p	HITS-CLIP	28735896
MIRT542838	hsa-miR-497-5p	HITS-CLIP	28735896
MIRT542838	hsa-miR-497-5p	HITS-CLIP	28735896
MIRT542838	hsa-miR-497-5p	HITS-CLIP	28735896
MIRT542838	hsa-miR-497-5p	HITS-CLIP	28735896
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	28735896
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	28735896
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	28735896
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	28735896
MIRT542827	hsa-miR-6886-5p	HITS-CLIP	28735896
MIRT542827	hsa-miR-6886-5p	HITS-CLIP	28735896
MIRT542830	hsa-miR-922	HITS-CLIP	28735896
MIRT542830	hsa-miR-922	HITS-CLIP	28735896
MIRT542830	hsa-miR-922	HITS-CLIP	28735896
MIRT542830	hsa-miR-922	HITS-CLIP	28735896
MIRT542838	hsa-miR-497-5p	HITS-CLIP	22927820
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	22927820
MIRT542836	hsa-miR-424-5p	HITS-CLIP	22927820
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	22927820
MIRT542834	hsa-miR-195-5p	HITS-CLIP	22927820
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	22927820
MIRT542832	hsa-miR-16-5p	HITS-CLIP	22927820
MIRT542838	hsa-miR-497-5p	HITS-CLIP	22927820
MIRT542837	hsa-miR-15a-5p	HITS-CLIP	22927820
MIRT542836	hsa-miR-424-5p	HITS-CLIP	22927820
MIRT542835	hsa-miR-15b-5p	HITS-CLIP	22927820
MIRT542834	hsa-miR-195-5p	HITS-CLIP	22927820
MIRT542833	hsa-miR-6838-5p	HITS-CLIP	22927820
MIRT542832	hsa-miR-16-5p	HITS-CLIP	22927820
MIRT542831	hsa-miR-4756-3p	HITS-CLIP	22927820
MIRT542830	hsa-miR-922	HITS-CLIP	22927820
MIRT542829	hsa-miR-4514	HITS-CLIP	22927820
MIRT542828	hsa-miR-4692	HITS-CLIP	22927820
MIRT542827	hsa-miR-6886-5p	HITS-CLIP	22927820
MIRT542838	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT542836	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT542834	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT542832	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT542838	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT542836	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT542834	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT542832	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT542831	hsa-miR-4756-3p	PAR-CLIP	21572407
MIRT542830	hsa-miR-922	PAR-CLIP	21572407
MIRT542829	hsa-miR-4514	PAR-CLIP	21572407
MIRT542828	hsa-miR-4692	PAR-CLIP	21572407
MIRT542838	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT542836	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT542834	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT542832	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT542838	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT542837	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT542836	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT542835	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT542834	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT542833	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT542832	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT542831	hsa-miR-4756-3p	PAR-CLIP	21572407
MIRT542830	hsa-miR-922	PAR-CLIP	21572407
MIRT542829	hsa-miR-4514	PAR-CLIP	21572407
MIRT542828	hsa-miR-4692	PAR-CLIP	21572407
MIRT542827	hsa-miR-6886-5p	PAR-CLIP	21572407
MIRT1219215	hsa-miR-1254	CLIP-seq
MIRT1219216	hsa-miR-1291	CLIP-seq
MIRT1219217	hsa-miR-15a	CLIP-seq
MIRT1219218	hsa-miR-15b	CLIP-seq
MIRT1219219	hsa-miR-16	CLIP-seq
MIRT1219220	hsa-miR-195	CLIP-seq
MIRT1219221	hsa-miR-3116	CLIP-seq
MIRT1219222	hsa-miR-3151	CLIP-seq
MIRT1219223	hsa-miR-3940-3p	CLIP-seq
MIRT1219224	hsa-miR-424	CLIP-seq
MIRT1219225	hsa-miR-4252	CLIP-seq
MIRT1219226	hsa-miR-4283	CLIP-seq
MIRT1219227	hsa-miR-4300	CLIP-seq
MIRT1219228	hsa-miR-4456	CLIP-seq
MIRT1219229	hsa-miR-4489	CLIP-seq
MIRT1219230	hsa-miR-4675	CLIP-seq
MIRT1219231	hsa-miR-4688	CLIP-seq
MIRT1219232	hsa-miR-4741	CLIP-seq
MIRT1219233	hsa-miR-4755-3p	CLIP-seq
MIRT1219234	hsa-miR-497	CLIP-seq
MIRT1219235	hsa-miR-541	CLIP-seq
MIRT1219236	hsa-miR-548q	CLIP-seq
MIRT1219237	hsa-miR-550a	CLIP-seq
MIRT1219238	hsa-miR-654-5p	CLIP-seq
MIRT1219239	hsa-miR-661	CLIP-seq
MIRT1219240	hsa-miR-920	CLIP-seq
MIRT1219217	hsa-miR-15a	CLIP-seq
MIRT1219218	hsa-miR-15b	CLIP-seq
MIRT1219219	hsa-miR-16	CLIP-seq
MIRT1219220	hsa-miR-195	CLIP-seq
MIRT1219224	hsa-miR-424	CLIP-seq
MIRT1219234	hsa-miR-497	CLIP-seq
MIRT1219217	hsa-miR-15a	CLIP-seq
MIRT1219218	hsa-miR-15b	CLIP-seq
MIRT1219219	hsa-miR-16	CLIP-seq
MIRT1219220	hsa-miR-195	CLIP-seq
MIRT1219224	hsa-miR-424	CLIP-seq
MIRT1219234	hsa-miR-497	CLIP-seq
MIRT1219217	hsa-miR-15a	CLIP-seq
MIRT1219218	hsa-miR-15b	CLIP-seq
MIRT1219219	hsa-miR-16	CLIP-seq
MIRT2291849	hsa-miR-1913	CLIP-seq
MIRT1219220	hsa-miR-195	CLIP-seq
MIRT2291850	hsa-miR-3189-5p	CLIP-seq
MIRT2291851	hsa-miR-324-3p	CLIP-seq
MIRT2291852	hsa-miR-342-5p	CLIP-seq
MIRT1219224	hsa-miR-424	CLIP-seq
MIRT2291853	hsa-miR-4512	CLIP-seq
MIRT2291854	hsa-miR-4664-5p	CLIP-seq
MIRT2291855	hsa-miR-4758-3p	CLIP-seq
MIRT1219234	hsa-miR-497	CLIP-seq
MIRT2291856	hsa-miR-670	CLIP-seq
MIRT1219217	hsa-miR-15a	CLIP-seq
MIRT1219218	hsa-miR-15b	CLIP-seq
MIRT1219219	hsa-miR-16	CLIP-seq
MIRT1219220	hsa-miR-195	CLIP-seq
MIRT1219224	hsa-miR-424	CLIP-seq
MIRT1219234	hsa-miR-497	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001783	Process	B cell apoptotic process	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002644	Process	Negative regulation of tolerance induction	IEA
GO:0002841	Process	Negative regulation of T cell mediated immune response to tumor cell	IDA	38377992
GO:0002903	Process	Negative regulation of B cell apoptotic process	IEA
GO:0005515	Function	Protein binding	IPI	15240681, 17489864, 20587542, 21982860, 23417675, 26602187, 28046066, 30487606
GO:0005886	Component	Plasma membrane	IDA	30487606
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	1396582
GO:0006959	Process	Humoral immune response	TAS	9332365
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0038023	Function	Signaling receptor activity	IDA	21276005, 38377992
GO:0050776	Process	Regulation of immune response	IBA
GO:0050777	Process	Negative regulation of immune response	IEA
GO:0050777	Process	Negative regulation of immune response	ISS
GO:0050868	Process	Negative regulation of T cell activation	IDA	21276005, 38377992
GO:0051241	Process	Negative regulation of multicellular organismal process	IEA
GO:0070234	Process	Positive regulation of T cell apoptotic process	IBA
GO:0070234	Process	Positive regulation of T cell apoptotic process	IEA
GO:1902482	Process	Regulatory T cell apoptotic process	IEA

Other IDs

• MIM: 600244
• HGNC: 8760
• e!Ensembl: ENSG00000188389

Protein

• UniProt ID: Q15116
• Protein name: Programmed cell death protein 1 (Protein PD-1) (hPD-1) (CD antigen CD279)
• Protein function: Inhibitory receptor on antigen activated T-cells that plays a critical role in induction and maintenance of immune tolerance to self (PubMed:21276005, PubMed:37208329). Delivers inhibitory signals upon binding to ligands CD274/PDCD1L1 and CD273/
• PDB: 2M2D, 3RRQ, 4ZQK, 5B8C, 5GGR, 5GGS, 5IUS, 5JXE, 5WT9, 6HIG, 6J14, 6J15, 6JBT, 6JJP, 6K0Y, 6R5G, 6ROY, 6ROZ, 6UMT, 6UMU, 6UMV, 6XKR, 7BXA, 7CGW, 7CU5, 7E9B, 7VUX, 7WSL, 7WVM, 8AS0, 8EQ6, 8GY5, 8U31, 8U32, 9HK1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	37 → 145	Immunoglobulin V-set domain	Domain

• Sequence:

  MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTS
  ESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGT
  YLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGS
  LVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVP
  CVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL

• Sequence length: 288

Pathways

KEGG:

Cell adhesion molecules
T cell receptor signaling pathway
PD-L1 expression and PD-1 checkpoint pathway in cancer

Reactome:

PD-1 signaling

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
PDCD1-related disorder	Benign; Likely benign	rs2227981, rs773116311, rs760386033, rs370660750	RCV003980768 RCV003939280 RCV003933821 RCV003931658 RCV003942181
RECLASSIFIED - PDCD1 POLYMORPHISM	Benign	rs11568821	RCV000009832

Associations from Text Mining
Disease Name	Relationship Type	References
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency	Associate	30783096
Abnormalities Drug Induced	Associate	33057635
Acetyl Coa Carboxylase Deficiency	Associate	36497046
ACTH Deficiency Isolated	Associate	30814440
ACTH Secreting Pituitary Adenoma	Associate	33112279
Actinic cheilitis	Associate	21442435
Acute Coronary Syndrome	Stimulate	26663396
Acute Disease	Associate	29636753, 36742309
Acute Lung Injury	Associate	37724530
Acute Phase Reaction	Inhibit	32639111
Adenocarcinoma	Associate	26183759, 28429196, 28487496, 32066859, 32435885, 32487090, 34367146, 35181584, 35228614, 35800186, 36052090, 36275893, 36445478, 36759392, 37359545, 38319303
Adenocarcinoma of Lung	Associate	26851185, 27346415, 28104537, 28201746, 28445137, 28451792, 28870260, 29127022, 30367104, 30544423, 31605439, 31619231, 31718573, 31879171, 31949130, 32005679, 32011450, 32077636, 32143735, 32158626, 32587640, 32686362, 34517527, 34752672, 34877770, 34887322, 34887858, 34933667, 35140113, 36688087, 36759392, 37006054, 37014183, 37033978, 37131252, 37341998, 37536668, 37567864, 37932988, 38022584, 39256604
Adenocarcinoma of Lung	Inhibit	32616892
Adenomatous Polyposis Coli	Associate	34986841
Adrenal Insufficiency	Stimulate	34042092
Adrenocortical Carcinoma	Associate	31644329, 38415841, 40109215
Adrenocortical Carcinoma Pediatric	Associate	39633439
Alopecia Neurologic Defects and Endocrinopathy Syndrome	Associate	28515940, 35115362
Amyloidosis Primary Cutaneous	Associate	28504999
Anemia Refractory with Excess of Blasts	Associate	26966176
Anodontia	Associate	19096012, 32963041, 36613564
Anodontia	Stimulate	33457080
Anorexia	Associate	35586668
Anthropophobia	Associate	34831335
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	36769297
Anus Neoplasms	Associate	29700411
Aortic Aneurysm Abdominal	Associate	37055467
Arthralgia	Inhibit	29254497
Arthralgia	Associate	29489833, 35115362
Arthritis	Associate	15188352, 28245522, 37858677
Arthritis Gouty	Associate	32639111
Arthritis Juvenile	Associate	15188352, 28056736, 33296081, 37086046
Arthritis Psoriatic	Inhibit	27542294, 29790686
Arthritis Psoriatic	Associate	29112182, 39662827
Arthritis Rheumatoid	Associate	15022318, 15188352, 15818672, 17064404, 17535987, 24742142, 27914594, 29112182, 29489833, 31061532, 32765511, 34654367, 36270740, 36640056, 36801909, 37457686, 39337675, 39586747
Arthritis Rheumatoid	Inhibit	23786396
Arthritis Rheumatoid	Stimulate	28150777
Ascites	Associate	30687337, 34359872, 35398623
Asthma	Associate	36804777
Ataxia Telangiectasia	Associate	30009527, 34737749, 38183111
Atrial Fibrillation	Associate	35600045
Autistic Disorder	Associate	27562213
Autoimmune Diseases	Associate	15022318, 18041714, 20190142, 22039410, 27077771, 28056736, 29359792, 30325236, 31781109, 33193306, 34183838, 35979531, 36189300, 36308011, 37858677, 40243636
Autoimmune Diseases	Inhibit	32616532, 36505471, 37930659
Autoimmune Diseases of the Nervous System	Associate	35131574
Bacterial Infections	Associate	33570446
Barth Syndrome	Associate	35418665
Basal cell carcinoma infundibulocystic	Associate	28943543
Bile Duct Neoplasms	Associate	28053236
Biliary Tract Neoplasms	Associate	32352498, 35967452, 37930138, 40414848
Bone Diseases Metabolic	Associate	30092832
Bone Marrow Diseases	Associate	27541170, 31556696
Brain Diseases	Associate	33611636, 35857126
Brain Injuries Traumatic	Associate	37348508
Brain Neoplasms	Associate	19028999, 30131293, 32017467, 33611636, 34596346, 34670827, 37272099, 38267913, 39593098
Brain Neoplasms	Inhibit	31424675
Breast Neoplasms	Associate	18294387, 26942414, 27117582, 27227944, 27912781, 28388539, 28537889, 29045526, 29063313, 29983831, 30069490, 30122122, 30318965, 30513096, 30519815, 30547271, 31081058, 31292534, 31591439, 31665365, 31839160, 32216835, 32266446, 32616706, 32681091, 32939056, 33112575, 33413541, 34185141, 34315723, 34319029, 34507558, 34542773, 34667028, 34741349, 34762599, 35121988, 35233733, 35614183, 35842661, 35894707, 36073303, 36088412, 36271406, 36388159, 36901916, 36951624, 37178414, 37377974, 37898851, 37963835, 38242720, 38267903, 39874011, 40108523, 40398661
Breast Neoplasms	Stimulate	30759303
Breast Neoplasms	Inhibit	35263601
Breast Neoplasms Male	Associate	30519815
Bronchiolitis Obliterans Syndrome	Inhibit	33193355
Bronchiolitis Obliterans Syndrome	Associate	34489963
Burkitt Lymphoma	Associate	28033393
Calcinosis	Associate	28974264
Calcinosis Cutis	Associate	30546030, 31501955, 31829518, 31973911, 32324435, 32964058, 33416945, 34697217, 34743688, 34817950, 34907653, 37808404
Cancer Pain	Associate	30771277, 31623599, 33000216
Carcinogenesis	Associate	27453418, 28571578, 32373223, 35499071
Carcinoma	Associate	28463396, 32332015, 33457085, 34103354, 37194064, 37926435, 40275321
Carcinoma Adenosquamous	Associate	36032124
Carcinoma Basal Cell	Associate	38101862
Carcinoma Ductal Breast	Associate	30085937
Carcinoma Endometrioid	Associate	38148043
Carcinoma Hepatocellular	Stimulate	19058313, 24672661
Carcinoma Hepatocellular	Associate	19826049, 21674477, 21876620, 21912640, 25427199, 25895129, 27034168, 28033288, 28624577, 29356308, 29375724, 29556041, 29666149, 29967316, 30506460, 30539869, 30719701, 30885723, 30939292, 31295151, 31337439, 31424675, 31558872, 31724091, 31731492, 31810126, 31927532, 32086577, 32587357, 32615319, 32863381, 32937024, 32945410, 33072070, 33118543, 33495920, 33993366, 34423049, 34689234, 34838121, 34839280, 34910956, 34925377, 34958112, 35236323, 35298067, 35316767, 35398623, 35592706, 35634309, 35812439, 35874743, 35902399, 36042180, 36062845, 36108710, 36118947, 36181013, 36464675, 36714595, 36830729, 37056769, 37058121, 37081394, 37131179, 37166013, 37173350, 37280393, 37377962, 37500263, 37584192, 37858067, 37928536, 38243049, 38421869, 38494878, 39321025, 39511687, 39712016, 39838375, 39867901, 40282408
Carcinoma Intraductal Noninfiltrating	Associate	32203210
Carcinoma Large Cell	Associate	33605014, 36263183
Carcinoma Lewis Lung	Associate	35211760
Carcinoma Lobular	Associate	26729235
Carcinoma Medullary	Associate	26965581, 28105368, 28807004
Carcinoma Merkel Cell	Associate	24416729, 28793172, 30976104, 31399473, 32324435, 32687503, 34706521, 37851052, 38241371
Carcinoma Mucoepidermoid	Associate	37274772
Carcinoma Neuroendocrine	Associate	36653904
Carcinoma Non Small Cell Lung	Associate	20514052, 25349974, 26439694, 26473645, 26851185, 27090296, 27470969, 27591097, 27699239, 27718847, 27745820, 27816392, 28275222, 28341875, 28451792, 28460468, 28503213, 28900290, 29119113, 29317551, 29337640, 29364514, 29431467, 29486723, 29499101, 29549910, 29658848, 29874226, 30297881, 30318514, 30337185, 30390416, 30405135, 30428640, 30548240, 30588196, 30591549, 30762312, 30842489, 30862891, 30895304, 30911841, 30956278, 30964529, 30972962, 30978241, 31053602, 31113840, 31159869, 31222843, 31527709, 31605795, 31606370, 31619231, 31654203, 31701630, 31718573, 31786291, 31879171, 31959728, 31959763, 32005679, 32077636, 32320754, 32433601, 32461348, 32493990, 32510574, 32554614, 32555523, 32591861, 32606052, 32793190, 32879421, 33017026, 33084148, 33108686, 33125909, 33149213, 33150733, 33498159, 33639962, 33655698, 33737428, 33751180, 33875760, 33883177, 33904361, 33927719, 33987445, 34054853, 34122444, 34194433, 34268872, 34332557, 34377595, 34382361, 34385342, 34572136, 34596346, 34668680, 34678907, 34679113, 34686497, 34750245, 34804000, 34849607, 34868057, 34893051, 34907653, 34912592, 34921023, 34972681, 35019173, 35101883, 35115705, 35131864, 35211760, 35216676, 35262683, 35277462, 35348622, 35493454, 35562908, 35618288, 35641540, 35708671, 35708776, 35750765, 35759816, 35857126, 35871223, 35904102, 35951090, 36002182, 36126963, 36159860, 36194200, 36199771, 36205311, 36281084, 36281948, 36331328, 36420269, 36516370, 36630992, 36657812, 36759392, 36798137, 36821809, 36822668, 36856921, 36868178, 36870519, 37017116, 37024582, 37094467, 37139142, 37141847, 37146414, 37167681, 37197440, 37256148, 37272099, 37304273, 37322912, 37453674, 37607911, 37620318, 37652510, 37726776, 37777573, 38022521, 38127362, 38212123, 38637361, 39308524, 39355355, 39596334, 39617650, 39743139
Carcinoma Non Small Cell Lung	Inhibit	28031159, 29657128, 30529903, 30796165, 30972766, 31088500, 32587640, 33227982, 33229510, 33458968, 33877652, 34290408, 34607896, 35253386, 36280845, 37180581, 37712645, 39377504, 39742281
Carcinoma Non Small Cell Lung	Stimulate	40318274
Carcinoma Ovarian Epithelial	Associate	32275468, 33914317, 37868997
Carcinoma Pancreatic Ductal	Associate	25827621, 27329602, 27768182, 28602029, 32495519, 32636837, 34202040, 34335594, 35037417, 35718340, 36281157, 36306792, 37116489, 37449210, 40244011
Carcinoma Renal Cell	Associate	20208540, 25583177, 26317902, 27292320, 27491898, 28832979, 29301960, 30131293, 30137025, 30564891, 30588196, 30972888, 30992011, 31064408, 31428993, 31646820, 31829518, 32277125, 32279409, 32396851, 32424467, 32493845, 33015999, 33389015, 33416945, 33537170, 33574053, 33605089, 33735492, 33797012, 33910834, 34002666, 34290908, 34446578, 34535962, 34563045, 34715028, 34953097, 36074149, 36479115, 36618968, 36734432, 36752726, 36849551, 36982415, 37221577, 37419794, 37653791, 37729872, 37943357, 38179741, 38599101, 40596969
Carcinoma Renal Cell	Inhibit	34607896
Carcinoma Signet Ring Cell	Associate	35042311
Carcinoma Small Cell	Associate	25582496
Carcinoma Squamous Cell	Stimulate	26134222
Carcinoma Squamous Cell	Associate	27879972, 29863979, 30108590, 30253973, 31141610, 31377718, 31605439, 31879171, 32139873, 32849590, 34716208, 34887858, 35095878, 35799269, 35813476, 35902966, 36032124, 36232331, 36281031, 36544782, 36759392, 37280525, 37338146, 37567864, 39477187
Carcinosarcoma	Associate	29386312, 34876047
Cardiofaciocutaneous syndrome	Associate	32020256
Cardiomyopathies	Inhibit	28026044
Cardiomyopathy Dilated	Stimulate	34669781
Cardiomyopathy Restrictive	Stimulate	34489963
Cardiovascular Diseases	Associate	28609832, 33009409, 33460396, 33868266, 35017151, 35885987, 35930205, 35977003, 36912199, 39333574
Cardiovascular Diseases	Stimulate	29606147, 34607896, 39277735
Cardiovascular Diseases	Inhibit	34099659, 35958603, 36505471
Carney Complex	Associate	37122702
CD59 Deficiency	Associate	18045485, 25675203, 28476944
Celiac Disease	Associate	32581063, 34220824
Cell Transformation Neoplastic	Inhibit	32616706
Charcot Marie Tooth disease Type 1C	Associate	29378266
Chemical and Drug Induced Liver Injury	Associate	21876620
Chemical and Drug Induced Liver Injury	Stimulate	29289977
Chills	Associate	34424037
Cholangiocarcinoma	Associate	30419854, 30885276, 31064408, 31200359, 31383016, 33239315, 34526987, 34603331, 35317832, 36159865, 36251029, 37247023, 37787790, 37973660, 38123132, 38547421, 39358645, 40589739
Cholestasis Extrahepatic	Associate	32615319
Cholestasis Intrahepatic	Associate	37928536
Chondrosarcoma	Associate	25906748
Chordoma	Associate	25349132, 29051990
Chromosomal Instability	Associate	37277193
Chromosome 1p36 Deletion Syndrome	Associate	39482002
Chronic Urticaria	Associate	23101188
Clear cell metastatic renal cell carcinoma	Associate	26424759, 30653744, 31651359, 35885987, 40274465
Colitis	Associate	32208873, 34147519, 35427471
Colitis Ulcerative	Associate	37273534
Colonic Diseases	Associate	29580042
Colonic Neoplasms	Associate	31061070
Colorectal Neoplasms	Associate	21179245, 26517354, 27198569, 27443512, 27552968, 27903500, 28403223, 28734759, 29580042, 30166615, 30172913, 30285662, 30670049, 30723299, 31038663, 31061070, 31078045, 31221124, 31429779, 31876399, 31921188, 32042474, 32111794, 32265897, 32393998, 32441316, 32468013, 33045001, 33264544, 33818637, 33849927, 34051513, 34083289, 34162716, 34349038, 34369992, 34797860, 34933913, 34975867, 35038827, 35181583, 35343934, 35762092, 35791694, 35930112, 35937946, 35958603, 36003387, 36119063, 36155259, 36295599, 36373163, 36389750, 36424637, 36479108, 36493599, 36528470, 36544760, 36599679, 36613564, 36656207, 36702949, 36773295, 36968142, 37002343, 37004094, 37059712, 37081776, 37172580, 37178411, 37239414, 37569431, 37607946, 37950153, 37986009, 38212126, 38302412, 38432446, 38583239, 39399495, 39456247, 40274385
Colorectal Neoplasms	Inhibit	28596308, 34544358, 35185898, 36846928, 37269904, 39739032
Colorectal Neoplasms	Stimulate	30081950
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	30723299, 31998307, 33140187, 34667028, 36338826
Common Variable Immunodeficiency	Associate	33876323, 34247288, 35562849
Communicable Diseases	Associate	34910956
Communication Disorders	Stimulate	37756307
Coronary Disease	Associate	33761687
COVID 19	Associate	32492530, 32679621, 33452008, 33768543, 33905951, 34163490, 34330510, 35222440, 35250975, 35364330, 35741107, 35860236, 35899493, 35971391, 36305225, 36430210, 37172423, 37240393, 38296596, 38408318
COVID 19	Stimulate	33617048, 36596303, 36768315
Craniopharyngioma	Associate	29509940
Crazy paving pattern	Associate	33545799
Critical Illness	Associate	28484052
Cross Infection	Stimulate	39684323
Cystic Disease Of Lung	Associate	35732550
Cystic Fibrosis	Associate	35732550
Cytomegalovirus Infections	Associate	20034645, 24148296, 29197680, 30624717, 33597150, 34671352
Cytomegalovirus Infections	Stimulate	32891157
Death	Associate	29440293, 29769438, 29970025, 30385085, 34102137, 35222440, 35427471, 36759392, 37180581
Dendritic Cell Sarcoma Follicular	Associate	28130401
Dermatitis	Associate	22377759
Desmoid disease hereditary	Associate	37098880
Diabetes Gestational	Stimulate	36203592
Diabetes Gestational	Associate	36513052
Diabetes Insipidus Neurogenic	Associate	34424037
Diabetes Mellitus	Associate	28418115, 28684632, 30650147, 37359544, 40244011
Diabetes Mellitus Type 1	Associate	25682896, 28418115, 28515940, 28877189, 30534571, 30814440, 31949260, 36169248, 37130628, 37498686, 37858677
Diabetes Mellitus Type 1	Inhibit	30650147
Diabetes Mellitus Type 2	Associate	27459386
Diabetic Ketoacidosis	Associate	30124874, 37359544
Diarrhea	Inhibit	29254497
Diarrhea	Associate	34102137, 35427471, 35586668, 39358463
Digestive System Neoplasms	Associate	34488388
Diplopia	Associate	28284331
Disease	Associate	30546030, 33402127, 35017151, 36528470, 37056769
Disease Progression	Associate	34106609
DNA Repair Deficiency Disorders	Associate	34992263
Down Syndrome	Associate	31699819
Drug Eruptions	Associate	26957557, 30385085
Drug Fever	Stimulate	34413168
Drug Related Side Effects and Adverse Reactions	Associate	26957557, 28072716, 29695768, 30901292, 35228614, 35470232, 36355079, 37355621, 39848112, 40205519
Drug Related Side Effects and Adverse Reactions	Stimulate	35115362
Duodenitis	Associate	32581063
Dwarfism Pituitary	Stimulate	36482425
Encephalitis	Associate	37644514
Encephalitis Viral	Associate	40352922
Endocrine System Diseases	Associate	30124874
Endometrial Neoplasms	Associate	27159395, 31370215, 31973911, 33001143, 33072070, 34124265, 34970268, 35242299, 35634444, 36199963, 36301137, 36509464, 36581331, 36805217, 37446260, 38238314, 39209049
Endometrial Neoplasms	Inhibit	33968059
Endometriosis	Associate	30325236, 34656305
Endotoxemia	Stimulate	25225461
Enteropathy Associated T Cell Lymphoma	Associate	34737749
Epidermal Cyst	Associate	39427497
Epstein Barr Virus Infections	Associate	19605492, 27807760, 35029211, 35734348, 35842661, 37138889, 37188668
Epstein Barr Virus Infections	Stimulate	27175027, 29155997, 33457080
Esophageal Neoplasms	Associate	27015293, 27577071, 31761900, 31882943, 32084010, 34067485, 36288460, 36466860, 37108474, 40587482
Esophageal Squamous Cell Carcinoma	Associate	27120796, 27453418, 31761900, 34009732, 34625514, 35022193, 35036077, 35046943, 36359828, 36466860, 37038094, 37355621, 38244291
Esophageal Squamous Cell Carcinoma	Inhibit	35365175
Exanthema	Inhibit	29254497
Exanthema	Associate	36159840
Familial cylindromatosis	Associate	32100077
Familial Primary Pulmonary Hypertension	Stimulate	39769220
Fatigue	Associate	35427471, 35586668, 36482425, 39358463
Fibrolamellar hepatocellular carcinoma	Associate	30902819
Fibrosis	Associate	31536177
Gallbladder Neoplasms	Associate	33328484, 35022908, 35242133, 39358463
Gastro enteropancreatic neuroendocrine tumor	Associate	30546030
Gastroesophageal Reflux	Associate	33856094
Gastrointestinal Neoplasms	Associate	31609250, 33180184, 35254400, 36996375
Gastrointestinal Neoplasms	Inhibit	34798858
Gastrointestinal Stromal Tumors	Associate	30714229, 30762585
GATA2 Deficiency	Associate	28188133, 29386072, 33376237, 34996890
Germinoma	Associate	29617441, 39958339
Gestational Trophoblastic Disease	Associate	36875956
Giant Cell Arteritis	Associate	31379838
Glioblastoma	Associate	27807100, 28178682, 29302887, 29532035, 30189044, 30742119, 31467175, 31604779, 31907277, 32151286, 32316275, 32401608, 32860048, 33177572, 34493595, 35717510, 35718749, 37529045, 38268923, 39874011, 40016450
Glioma	Associate	24375192, 26578623, 27370400, 28620836, 29396294, 31801484, 31819973, 32401608, 33140187, 34188042, 34728682, 35265072, 35481923, 36159811, 36311792, 37543576, 39740094, 40696074
Glioma	Inhibit	37330579
Gliosarcoma	Associate	27370400, 34162346, 34876047
Glomerulonephritis	Associate	28770269, 33121190
Glomerulonephritis Membranous	Associate	37075987
Glucosephosphate Dehydrogenase Deficiency	Associate	32474122
Goiter Multinodular 2	Associate	36420264
Graft vs Host Disease	Associate	28468799, 33868266, 34671352
Granulomatous Disease Chronic	Associate	33570446
Granulosa cell tumor of the ovary	Associate	39958339
Graves Disease	Associate	34494503
Graves Disease	Inhibit	35619700
Graves Ophthalmopathy	Associate	35619700
Hand Foot Syndrome	Associate	35586668
Hashimoto Disease	Associate	28974264, 34494503
Head and Neck Neoplasms	Associate	28408386, 29362132, 30108590, 30219915, 32699939, 33793576, 34755131, 35140722, 36395141
Heart Diseases	Inhibit	31780628
Heart Diseases	Associate	31851923
Hemangiosarcoma	Associate	30801864
Hematologic Neoplasms	Inhibit	27269947
Hematologic Neoplasms	Associate	30761875
Hepatitis Autoimmune	Associate	28257599
Hepatitis B	Associate	24672661, 25895129, 27034168, 28033288, 28662185, 29739341, 30939292, 31464942, 33833369, 34910956, 36635631
Hepatitis B	Stimulate	35317832
Hepatitis B Chronic	Associate	29666149, 30939292
Hepatitis C	Associate	32937024
Hepatitis C Chronic	Stimulate	32994477
Hepatitis Chronic	Associate	31781109
Hereditary Autoinflammatory Diseases	Associate	35222440
Hereditary leiomyomatosis and renal cell cancer	Associate	18203952, 23598959, 29394125, 30783096, 31816062
Histiocytic Sarcoma	Associate	36969238
HIV Infections	Stimulate	19197939, 34149690
HIV Infections	Associate	19564339, 20208540, 21985367, 22713261, 22916009, 23403273, 24522925, 24739950, 25093660, 26402620, 27415008, 27525551, 27981723, 28762530, 29563914, 29641325, 29746296, 30624717, 31394407, 31533030, 31578868, 31827152, 32508817, 32891157, 34597347, 34672108, 36198308, 38364104
Hodgkin Disease	Associate	18203952, 19096012, 25482239, 26678894, 27354476, 27451390, 28468799, 28893733, 29394125, 29949442, 30261066, 30514251, 30564891, 30783096, 31697809, 31816062, 32143684, 33113552, 33620088, 34584203, 34941990, 34980000, 35572591, 35833296, 36083129, 37642071, 40030000
HTLV I Infections	Associate	36580634
Hyperglycemia	Associate	28418115
Hypertension Pulmonary	Associate	36263036
Hypoglycemia	Stimulate	36482425
Hypophysitis	Stimulate	31518074
Hypothyroidism	Inhibit	29254497, 30124874
Hypothyroidism Autoimmune	Associate	30124874
Hypoxia	Associate	34484235, 37067635
Hypoxia	Stimulate	36445478, 36494419
Hypoxia Brain	Associate	37377902
Idiopathic Noncirrhotic Portal Hypertension	Associate	28033288
Idiopathic Pulmonary Fibrosis	Associate	37121574
Idiopathic subglottic tracheal stenosis	Stimulate	32557663
IgA Vasculitis	Associate	27769184
Immune Reconstitution Inflammatory Syndrome	Associate	32761425
Immune System Diseases	Associate	18490780, 28074937, 30122122, 30759303, 31781109, 33421299, 33839757, 34349753, 34597347, 35769457, 37858677
Immunologic Deficiency Syndromes	Associate	31617320
Infections	Associate	18462013, 26378166, 26517304, 30870532, 35732550, 35967314, 36150362
Infectious Mononucleosis	Associate	20886079
Infertility	Associate	25399062
Inflammation	Associate	19739236, 22634051, 27683114, 28245522, 28624577, 30232328, 30422099, 31100059, 31684954, 31851923, 32457125, 32710922, 33268821, 33296081, 33452008, 33777025, 33837006, 33910834, 34817950, 35441668, 35600045, 35732550, 35848481, 35930205, 36118947, 36443332, 36669143, 36804777, 37086046, 37366893, 37724530, 38012210
Inflammation	Stimulate	20208540, 25349132, 35986756
Inflammation	Inhibit	31731492, 31780628, 37037616
Inflammatory Bowel Diseases	Associate	26305224, 35848481
Inflammatory Breast Neoplasms	Associate	30777104, 33267869, 34104544, 34445631, 34542773, 35842661
Insulin Resistance	Inhibit	30759303
Intestinal Neoplasms	Associate	29332341, 30969179
Intestinal Perforation	Associate	35427471
Kidney Diseases	Associate	30124874, 36275893, 39277735
Klatskin Tumor	Associate	37095160
Kotzot Richter syndrome	Associate	37738974
Langerhans Cell Sarcoma	Associate	34713856
Laryngeal Neoplasms	Associate	34356594
Laryngotracheal Stenosis Progressive with Short Stature and Arthropathy	Associate	32557663
Lateral meningocele syndrome	Associate	25906748
Lead Poisoning Nervous System	Associate	35260804
Learning Disabilities	Associate	37348508
Leiomyosarcoma	Associate	30388926
Leprosy	Associate	23283468
Leprosy Tuberculoid	Stimulate	23283468
Leukemia	Associate	20682852, 27708227, 29697355, 34103328, 36960055, 37457737, 37554265
Leukemia Biphenotypic Acute	Associate	34365737
Leukemia Lymphocytic Chronic B Cell	Associate	23247726, 24246502, 27302925, 28075442, 28424162, 29697355, 30761875, 35149845, 35193595
Leukemia Lymphoma Adult T Cell	Associate	29845702, 30385085
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	28049640
Leukemia Myeloid Acute	Associate	26219463, 28629373, 28693586, 29697355, 29908544, 30500073, 31291985, 31406210, 32020256, 32245463, 33057635, 33072070, 33495835, 33649342, 33758676, 33868266, 34129052, 34171128, 34663807, 35297213, 36653976, 37298237, 37457737, 37602517, 37759316, 38615511, 40225861, 40555045
Leukemia Prolymphocytic T Cell	Associate	36273464
Leukemia Promyelocytic Acute	Associate	38615511
Leukocyte adhesion deficiency type 1	Associate	33495835
Leukoencephalopathy Progressive Multifocal	Associate	22549384, 30864100
Leukopenia	Associate	35586668
Leukoplakia	Associate	36860910, 37971722
Lichen Planus	Associate	36825932
Lichen Planus Oral	Associate	39369184
Lichenoid Eruptions	Associate	33423421
Light Fixation Seizure Syndrome	Associate	37057033
Liposarcoma	Associate	25906748, 34465597
Liposarcoma Myxoid	Associate	31171504
Liver Cirrhosis	Stimulate	24672661
Liver Cirrhosis Biliary	Associate	18041714
Liver Diseases	Associate	19739236, 25895129, 31464942, 32937024, 33833369, 34497613, 34910956, 38268921
Liver Failure	Associate	24672661
Liver Failure	Stimulate	36635631
Liver Neoplasms	Associate	37967215
Lung Diseases	Stimulate	28169347
Lung Diseases	Associate	32350591, 32557663, 35732550, 36439147, 37274772
Lung Diseases	Inhibit	32652936
Lung Diseases Interstitial	Associate	27599705, 34654367
Lung Injury	Inhibit	34483230
Lung Neoplasms	Associate	26014096, 26183035, 26183759, 27393506, 27447482, 27470969, 27502709, 28061450, 28289860, 28980429, 29132144, 29658848, 30165371, 30305853, 30986912, 31005568, 31086949, 31903110, 31923366, 32238919, 32396674, 32788875, 32793190, 33205076, 33479024, 33545799, 33793576, 33818637, 33956842, 34149722, 34324065, 34663810, 34767762, 34907653, 35273829, 35389889, 35586668, 36520426, 36561745, 37274772, 37378668, 37977237, 38177076, 39277735
Lung Neoplasms	Inhibit	34290408, 34437586, 36960400, 37979167
Lupus Erythematosus Systemic	Associate	15022318, 15188352, 15334473, 15818672, 15934088, 17064404, 17344889, 17535987, 19116915, 20178125, 21952918, 25098715, 25581113, 25938972, 26108738, 26782401, 27914594, 28056736, 31536480, 31781109, 32996897, 34101055, 34240405, 36189300, 38233074
Lupus Erythematosus Systemic	Stimulate	33777025
Lupus Nephritis	Associate	31536480
Lupus Nephritis	Inhibit	34081342
Lymphatic Metastasis	Associate	26403784, 27453418, 27741514, 31492714, 34907653, 35388548, 36042498, 36359828, 37501393
Lymphatic Metastasis	Stimulate	30539869
Lymphohistiocytosis Hemophagocytic	Associate	36969238
Lymphoma	Associate	22918164, 26850007, 27564404, 28356247, 28468799, 29998979, 30723112, 31184237, 31292525, 31556696, 33591648, 33876323, 35081690, 35572591, 35895386
Lymphoma	Inhibit	31672704, 33335718
Lymphoma B Cell	Associate	24497532, 27268263, 28490569, 28504999, 29293620, 31471540, 31609651, 31697821, 38615378
Lymphoma B Cell Marginal Zone	Associate	29293620, 32963045
Lymphoma Extranodal NK T Cell	Associate	34996890
Lymphoma Follicular	Associate	20944673, 23297127, 25700246, 33133070, 35816682
Lymphoma Large B Cell Diffuse	Associate	12594241, 27030389, 27147575, 27760757, 28403071, 28662185, 31195368, 31570691, 32079690, 32267932, 33787861, 34077007, 34422089, 37326144, 37841254, 37976136, 39844281, 39914494
Lymphoma Large Cell Anaplastic	Associate	30093402
Lymphoma Mantle Cell	Associate	30821551
Lymphoma Non Hodgkin	Associate	33955303, 35181584, 36076202, 37543576
Lymphoma T Cell	Stimulate	18203952
Lymphoma T Cell	Associate	19329936, 20207847, 28943543, 31029646, 31556696, 32143684
Lymphoma T Cell Cutaneous	Associate	20713771, 29895574, 32760603, 36649072, 37427589
Lymphoma T Cell Peripheral	Associate	23598959, 33436023, 35895386
Lymphoma T Cell Peripheral	Inhibit	30054295
Lymphopenia	Stimulate	39684323
Lymphoproliferative Disorders	Associate	32937024
Malaria	Associate	33617048
Malignant mesenchymal tumor	Associate	36104728
Mastocytosis Cutaneous	Associate	29378725
Medulloblastoma	Associate	36825029
Melanoma	Associate	19651643, 22850568, 24343228, 25720800, 25944800, 26763445, 26822383, 26940869, 26957557, 26966176, 27433843, 27650038, 27671167, 27837027, 27846054, 28026870, 28084337, 28324889, 28331615, 28397821, 28434031, 28476944, 28681063, 29320474, 29410200, 29546435, 29606147, 29970025, 29973670, 30131384, 30167863, 30175642, 30343532, 30355485, 30588196, 30718426, 30728070, 30804515, 30806748, 30824584, 30880120, 30925943, 31151362, 31171879, 31275310, 31300034, 31412814, 31484081, 31488153, 31506076, 31532537, 31625630, 31652661, 31677253, 31703593, 31792460, 31796647, 32036449, 32042196, 32120023, 32160899, 32162809, 32296058, 32312968, 32316408, 32350591, 32463489, 32939320, 33077770, 33128316, 33266349, 33294862, 33483342, 33495600, 33504219, 33506034, 33707233, 33872982, 33914706, 33922038, 33963011, 34028390, 34112666, 34177913, 34179721, 34290710, 34326162, 34654806, 34675925, 34737735, 34764492, 34795662, 34933966, 34950838, 34983745, 35087523, 35094125, 35192052, 35193932, 35247927, 35263570, 35280982, 35284940, 35302641, 35430568, 35550554, 35768432, 35793874, 35798536, 35874702, 36003398, 36052016, 36112545, 36169985, 36180872, 36232946, 36248850, 36273464, 36433984, 36450385, 36512357, 36573964, 36593066, 36614248, 36671443, 36719749, 37016119, 37037616, 37060248, 37072748, 37115668, 37229906, 37479483, 37507765, 37525015, 37660535, 37665297, 37808404, 37865395, 37887546, 37889972, 38082384, 38171116, 38243078, 38303608, 39237877, 39273294, 39354418, 39357979, 39684692, 39796063, 40023845, 40030000, 40056560, 40089202, 40133499, 40149458, 40222200, 40226614
Melanoma	Inhibit	30124874, 30412106, 31727009, 33335718, 35107815, 36139377, 37880788, 39394099
Melanoma Cutaneous Malignant	Associate	29185395, 31138334, 32457125, 33746582, 35116193, 36466837, 37662962, 38155221, 38279987
Meningeal Neoplasms	Associate	32571131
Meningioma	Associate	25609200
Mesothelioma	Associate	30245692, 36669143, 36901697
Mesothelioma Malignant	Associate	34572136, 34987640, 36115921, 36669143, 36901697, 39966970
Microsatellite Instability	Stimulate	25358689, 31530839, 33229401
Microsatellite Instability	Associate	25583798, 30172913, 31221124, 32272210, 32369650, 32453797, 33264544, 33844372, 33856094, 36996375, 37150803
Microsatellite Instability	Inhibit	26982367, 36528470
Monoclonal Gammopathy of Undetermined Significance	Associate	31428081
Mood Disorders	Associate	28074937
Mouth Diseases	Associate	30385085, 32546692, 33777045
Mucor infection	Associate	36305225
Multiple Myeloma	Associate	30761875, 33013907, 33303710, 33735518, 33890981, 34502204, 36355079, 36532059, 37122695
Multiple Sclerosis	Associate	25360562, 28284331, 28767147, 31780628, 35383094, 36308011
Multiple Sulfatase Deficiency Disease	Associate	35427471
Myalgia	Inhibit	29254497
Myasthenia Gravis	Associate	39346912
Mycosis Fungoides	Associate	22377759, 22722467, 22918164, 30328260, 35194801
Myelodysplastic Syndromes	Associate	20472834, 26966176, 27565576, 31406210, 33730109, 36003379, 36282797, 36810783
Myocardial Ischemia	Associate	25385851
Myocarditis	Associate	39333574
Myoclonic Epilepsies Progressive	Associate	31697809
Myopathies Structural Congenital	Associate	27268263, 37851052
Myositis	Associate	35371068
Nasal Polyps	Associate	36804777
Nasopharyngeal Carcinoma	Associate	25361008, 28380458, 31138162, 32564263, 33492986, 33737344, 36438903, 37188668, 40083932
Nasopharyngeal Neoplasms	Associate	37207653
Nausea	Associate	34102137
Neoplasm Invasiveness	Associate	32203210
Neoplasm Metastasis	Associate	27009855, 28201746, 28380458, 28524161, 29336717, 30547271, 32084010, 32151286, 32542563, 33413541, 33611636, 34021032, 34051513, 34322779, 34980602, 35225458, 35857126, 36812781, 37955535, 38012210
Neoplasm Metastasis	Inhibit	30203045, 36096531
Neoplasm Recurrence Local	Associate	30767115
Neoplasm Residual	Associate	39742281
Neoplasms	Associate	18203952, 18294387, 20460501, 20514052, 20682852, 21368758, 21408177, 21442435, 21577144, 21876620, 21912640, 22461641, 23160205, 23460533, 23598959, 23681603, 24297569, 24343228, 24349382, 24352453, 24416729, 24667641, 24714771, 24842267, 25349132, 25355681, 25358689, 25427199, 25428504, 25701326, 25720800, 25774992, 25805798, 25990251, 26028255, 26175412, 26183035, 26216948, 26239088, 26313362, 26375401, 26420858, 26439694, 26473645, 26542241, 26578623, 26625204, 26762740, 26771840, 26785144, 26871470, 26901407, 26940869, 26982367, 27015293, 27090296, 27135656, 27147575, 27147580, 27159395, 27175027, 27191652, 27213372, 27221508, 27227944, 27267608, 27269947, 27329602, 27346415, 27362903, 27393385, 27429197, 27443512, 27453418, 27456947, 27486176, 27519280, 27525433, 27541170, 27552968, 27564404, 27565906, 27589570, 27618663, 27650038, 27665539, 27777771, 27782862, 27837027, 27861596, 27868139, 27870715, 27879972, 27903500, 27922697, 27934877, 27960080, 28003187, 28052254, 28072716, 28075442, 28086852, 28122336, 28125702, 28201746, 28230773, 28251903, 28289860, 28334399, 28342215, 28344809, 28351930, 28371827, 28388539, 28397821, 28403071, 28404915, 28406723, 28408386, 28420421, 28423520, 28424162, 28429196, 28438290, 28445951, 28446615, 28459943, 28460468, 28468947, 28487496, 28494868, 28501937, 28503213, 28504999, 28539123, 28539467, 28596308, 28602029, 28608950, 28650338, 28678778, 28681063, 28730785, 28813410, 28832075, 28832979, 28837143, 28880903, 28886381, 28922567, 28931635, 28934595, 29027395, 29042640, 29045526, 29185395, 29197680, 29275316, 29309048, 29311707, 29312460, 29332341, 29336717, 29337640, 29351920, 29356308, 29365144, 29375724, 29410488, 29427150, 29431467, 29440293, 29449680, 29596910, 29615063, 29617441, 29617666, 29672601, 29702286, 29713040, 29747685, 29791021, 29843803, 29854854, 29899191, 29910795, 29929551, 29949442, 29983831, 29992241, 30009527, 30021101, 30066852, 30069490, 30072391, 30075702, 30089500, 30122122, 30166615, 30167863, 30172913, 30194079, 30282672, 30305853, 30309915, 30325558, 30337185, 30353144, 30355485, 30388926, 30400799, 30505306, 30513096, 30519815, 30530635, 30539869, 30546030, 30547271, 30588196, 30600651, 30634925, 30719701, 30723299, 30723303, 30728081, 30742119, 30760860, 30770361, 30770752, 30807610, 30816272, 30880120, 30895946, 30901292, 30902819, 30911684, 30935099, 30935888, 30964529, 30972888, 30979816, 30986912, 31053602, 31061070, 31064408, 31069878, 31074879, 31090214, 31138162, 31143450, 31159869, 31171504, 31200359, 31221124, 31236579, 31240875, 31266769, 31275310, 31286289, 31300681, 31327656, 31337644, 31354725, 31379843, 31383967, 31399602, 31413142, 31431617, 31432577, 31439614, 31464522, 31481117, 31492714, 31506389, 31511925, 31532833, 31533865, 31558872, 31605439, 31606370, 31609250, 31637475, 31640780, 31640814, 31653140, 31655605, 31672701, 31697809, 31703637, 31704149, 31724091, 31730010, 31755433, 31761900, 31796994, 31800094, 31844270, 31855576, 31911269, 31915129, 31973911, 31980961, 32012401, 32019858, 32028264, 32042474, 32051287, 32111794, 32114502, 32134754, 32151286, 32173382, 32192573, 32200422, 32210369, 32238919, 32240238, 32304268, 32312968, 32332015, 32366559, 32369650, 32373223, 32385241, 32393998, 32429929, 32430031, 32433601, 32441316, 32500232, 32500560, 32509862, 32518054, 32523987, 32540858, 32542563, 32554614, 32557663, 32603654, 32606053, 32615319, 32616555, 32616706, 32681091, 32686757, 32697949, 32710922, 32736208, 32760603, 32849590, 32854442, 32857184, 32860814, 32867715, 32922390, 32938429, 32943749, 32987122, 33043814, 33072070, 33087896, 33098265, 33101772, 33106165, 33113005, 33118543, 33140187, 33149213, 33160076, 33173935, 33215787, 33219016, 33229401, 33230973, 33264544, 33267869, 33329517, 33329573, 33332284, 33350050, 33389015, 33402116, 33413541, 33417831, 33423421, 33452008, 33457085, 33460396, 33460964, 33479024, 33479027, 33522069, 33523034, 33537170, 33570446, 33579170, 33599686, 33655698, 33761687, 33762319, 33826281, 33876323, 33885944, 33910834, 33914317, 33914706, 33932141, 34028936, 34042092, 34067485, 34076351, 34077007, 34098061, 34099659, 34104539, 34106609, 34122444, 34124265, 34126195, 34127502, 34140315, 34156677, 34193438, 34218652, 34240815, 34267742, 34272316, 34272988, 34322779, 34346836, 34349241, 34356594, 34362334, 34424037, 34433588, 34434611, 34435978, 34445631, 34482260, 34484468, 34505280, 34510503, 34516729, 34552581, 34603331, 34625514, 34654806, 34681840, 34689234, 34706521, 34737735, 34738358, 34741349, 34755133, 34767045, 34782426, 34794456, 34798858, 34838121, 34873013, 34899684, 34907653, 34910956, 34933966, 34950838, 34956194, 34983745, 34996890, 35022193, 35046943, 35062993, 35069542, 35091445, 35124891, 35154166, 35154907, 35188805, 35227680, 35243806, 35246970, 35250967, 35263569, 35263601, 35273829, 35281032, 35291960, 35304622, 35315710, 35316767, 35317832, 35320356, 35357903, 35371041, 35373505, 35385572, 35422531, 35430568, 35435450, 35456895, 35470232, 35493449, 35493519, 35504956, 35508972, 35525858, 35545291, 35552271, 35581573, 35589776, 35618285, 35647908, 35651625, 35664082, 35675963, 35707390, 35732550, 35762092, 35768432, 35769457, 35778636, 35783358, 35793874, 35802807, 35811317, 35851309, 35882970, 35915658, 35922773, 35951090, 35972693, 35986756, 36002182, 36003398, 36007522, 36032097, 36045683, 36104728, 36115921, 36117149, 36130508, 36169254, 36181013, 36194583, 36224560, 36232331, 36263183, 36271406, 36271507, 36280845, 36281031, 36281084, 36288460, 36295599, 36300124, 36319064, 36323740, 36331328, 36355079, 36389676, 36389750, 36401133, 36417489, 36420269, 36428963, 36443332, 36451810, 36466860, 36468941, 36494005, 36518249, 36555243, 36581331, 36599679, 36618415, 36623238, 36657812, 36671443, 36675305, 36728032, 36732592, 36737759, 36773295, 36780540, 36793050, 36810783, 36812781, 36821809, 36865537, 36880750, 36901916, 36945968, 36947985, 37002343, 37031300, 37036308, 37037616, 37053197, 37060363, 37067635, 37080610, 37081749, 37115668, 37116489, 37127565, 37164450, 37175900, 37208129, 37208608, 37221577, 37247023, 37264024, 37279009, 37286702, 37311357, 37328649, 37330579, 37344099, 37349318, 37390206, 37399175, 37427589, 37446260, 37449205, 37497337, 37535195, 37542121, 37583448, 37586767, 37599324, 37653392, 37683037, 37728660, 37729362, 37738974, 37777573, 37793854, 37802025, 37858677, 37904615, 37923822, 37930659, 37944524, 37946136, 37970473, 37970475, 37973660, 37977237, 37979167, 37992442, 38048735, 38052215, 38062068, 38101862, 38136558, 38148043, 38164172, 38167274, 38169917, 38173030, 38212124, 38212126, 38243078, 38292771, 38350448, 38384031, 38420990, 38432446, 38489268, 38514081, 38522774, 39201462, 39201772, 39249543, 39256604, 39300183, 39308524, 39321200, 39323009, 39325190, 39427497, 39529169, 39532274, 39617650, 39620210, 39796063, 39958339, 40076932, 40102418, 40149458, 40244846, 40270290, 40391211, 40565313, 40612859, 40643554, 40777041
Neoplasms	Stimulate	25257362, 29155997, 31921188, 32695108, 36472588, 37928536, 39456247, 40547009
Neoplasms	Inhibit	26763445, 28515940, 29057919, 29345283, 29606147, 30709339, 32350591, 33523584, 33584705, 33968059, 35553632, 35619700, 36139065, 36380966, 37201522, 37318496, 38016475, 38327131
Neoplasms Germ Cell and Embryonal	Associate	26171934, 27638840, 39958339
Neoplasms Squamous Cell	Associate	33479027, 36280845
Neuroblastoma	Associate	33239635, 35525858, 38125723, 39289439
Neuroendocrine Tumors	Associate	33230973, 36653904, 40244846
Neurofibrosarcoma	Associate	34218652, 39321200
Neutropenia	Associate	35427471
Neutrophil Immunodeficiency Syndrome	Associate	32457125, 35427471
Niemann Pick Disease Type C	Associate	37580352
Nijmegen Breakage Syndrome	Associate	32695108
Non Muscle Invasive Bladder Neoplasms	Associate	29051990, 30257862, 32367308, 35039625, 35227680, 36793050, 37955535, 39367493
Non Muscle Invasive Bladder Neoplasms	Inhibit	35398827
Obesity	Inhibit	33197880
Obesity	Associate	36714595, 39765379
Osteoporosis	Associate	29924424, 32065479
Osteosarcoma	Associate	24866169, 27456063
Ovarian Diseases	Associate	32334621, 35046435
Ovarian Neoplasms	Associate	17360651, 24297569, 26871470, 26937756, 27986748, 28730785, 29171986, 29843813, 31492714, 31980961, 32193378, 32446718, 33189611, 33492447, 34075161, 34322886, 34656305, 34768993, 34946254, 35026984, 35289120, 35545291, 35552618, 35838045, 36275748, 36561981, 36726489, 37179293, 37339172, 37759229, 37791232, 37868825, 38095409, 39608974
Overtraining Syndrome	Inhibit	38319611
Overweight	Associate	36714595
Pain	Associate	30771277
Pancreatic Neoplasms	Associate	25795132, 27777771, 28241889, 28798308, 31440238, 32051287, 32114502, 32643277, 34459462, 36224560, 36341552, 37116489, 37127565, 37130628, 37339979, 38012210
Pancreatitis Chronic	Inhibit	31851923
Papilloma	Associate	22322668, 38193541
Paralysis	Associate	36130508
Paraneoplastic Syndromes	Stimulate	35131574
Paraparesis Tropical Spastic	Inhibit	23409198
Parkinson Disease	Associate	33552685
Pemphigoid Bullous	Associate	31474998
Periodontitis	Associate	34502071
Peripheral Nervous System Diseases	Associate	34102137
Peritoneal Neoplasms	Associate	31497016
Peritonitis	Stimulate	37768208
Perivascular Epithelioid Cell Neoplasms	Associate	34301321
Persistent Infection	Associate	34350463
Pigmented purpuric eruption	Associate	30385085
Pituitary Neoplasms	Associate	32652004, 34745002, 36161330
Plasmablastic Lymphoma	Associate	27175027
Pleural Effusion	Associate	28289860, 31639551
Pleural Effusion Malignant	Associate	27447482, 27544053, 32276643
Pleural Effusion Malignant	Inhibit	30762312
Pleuropulmonary blastoma	Associate	34266329
Pneumonia	Associate	28072716, 36171010
Pneumonia	Inhibit	31310589
Polycystic Ovary Syndrome	Associate	33521133
Polypoidal Choroidal Vasculopathy	Associate	36804777
Polyps	Associate	36804777
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Associate	39456897
Porphyria Acute Intermittent	Associate	25906748
Post Acute COVID 19 Syndrome	Stimulate	34611034
Post Acute COVID 19 Syndrome	Associate	35401523, 36997530, 37753077
Pre Eclampsia	Associate	28890543
Pre Eclampsia	Inhibit	35177223
Precancerous Conditions	Associate	28438290
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	32268011
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	27565576, 31400961, 37532715
Primary Myelofibrosis	Associate	32732359, 34581778
Prostatic Hyperplasia	Associate	26993768
Prostatic Neoplasms	Associate	26260996, 27429197, 28223102, 28460462, 31431617, 31545446, 32453797, 32552802, 33215787, 33402116, 33569050, 33899001, 33934205, 34417325, 34445612, 34737749, 35772050, 36522531, 37067635, 37223924, 38087324, 39265220
Prostatic Neoplasms Castration Resistant	Inhibit	32916128
Prostatitis	Associate	19670224, 32916128
Pulmonary Arterial Hypertension	Stimulate	39769220
Pulmonary Disease Chronic Obstructive	Associate	22829758, 26517304, 35732550, 35991707
Pulmonary Disease Chronic Obstructive	Stimulate	28934595, 30349227
Pulmonary Fibrosis	Associate	25536276
Purpura Thrombocytopenic Idiopathic	Associate	25561904, 27077771, 29333980, 29359792, 33584705
Q Fever	Associate	25211350
Recombinant chromosome 8 syndrome	Associate	37264024
Rectal Neoplasms	Associate	35352512, 35660797, 36030556, 36119063, 37441082, 38381429
Respiratory Distress Syndrome	Associate	29769438, 33452008, 37724530
Respiratory Tract Neoplasms	Associate	30842242
Retinoblastoma	Associate	32100078
Retrograde Degeneration	Associate	40474176
Retroperitoneal liposarcoma	Associate	31385405
Rhabdomyosarcoma	Associate	31704149, 35371041
RNA Virus Infections	Associate	33452008
Salivary Duct Calculi	Associate	31237963
Sarcoidosis	Associate	25073001, 29234685, 29898781, 37863732
Sarcoma	Associate	24349382, 25805798, 25906748, 28463396, 30963193, 32792357, 33762319, 34218652, 34817950, 35448937, 35986756, 37661910
Sarcoma Ewing	Associate	27259563
Sarcoma Kaposi	Associate	31394407
Sarcoma Synovial	Associate	31171504
Scleritis	Stimulate	36118947
Sebaceous Gland Neoplasms	Associate	29914578, 31755433
Seizures	Associate	23073310
Sepsis	Associate	26183035, 27459386, 30747773, 31484735, 35732550, 37724530, 39684323, 40398661
Sezary Syndrome	Associate	22918164, 32760603, 34570200, 35758515
Sezary Syndrome	Stimulate	30328260
Shock Septic	Associate	28072859
Sialadenitis	Associate	12528117, 36482425
Sjogren's Syndrome	Associate	12528117, 24574234, 31412888, 32963045
Sjogren's Syndrome	Stimulate	35020842
Sjogren's Syndrome	Inhibit	36482425
Skin Diseases	Associate	26957557
Skin Diseases	Stimulate	36825932
Skin Diseases Vascular	Associate	26957557
Skin Manifestations	Associate	15934088
Skin Neoplasms	Associate	27879972
Sleep Apnea Obstructive	Associate	34768806
Small Cell Lung Carcinoma	Associate	28586388, 34006632, 34228218, 34329846, 35586668
Small Cell Lung Carcinoma	Inhibit	34907653
Smoke Inhalation Injury	Inhibit	30140263
smoker's inclusion bodies	Associate	34413168
Soft Tissue Injuries	Associate	27213372
Spinocerebellar Degenerations	Associate	30018250, 36479108
Spinocerebellar Degenerations	Stimulate	35937946
Spondylitis Ankylosing	Associate	17064404
Squamous Cell Carcinoma of Head and Neck	Associate	21442435, 23288508, 27777979, 28460011, 28487502, 28756882, 28947422, 28948509, 29345283, 29416107, 29440293, 29467336, 30576970, 30767115, 31379843, 31527697, 31674884, 32124416, 32183719, 32238919, 32381551, 32546692, 32697949, 32943444, 33513276, 33995377, 34187851, 34657509, 34668665, 34737735, 34755131, 34755137, 34823553, 34862248, 34965944, 35225458, 35281069, 35768785, 35794182, 35941227, 36224603, 36597662, 37057033, 37366893, 37666053, 37713790, 38159908, 39549431
Squamous Cell Carcinoma of Head and Neck	Inhibit	33138288, 38066522
Stevens Johnson Syndrome	Associate	26957557
Stevens Johnson Syndrome	Stimulate	33423421
Stomach Diseases	Associate	40275321
Stomach Neoplasms	Associate	27147580, 27241062, 27741514, 28056089, 28207501, 29673110, 30018250, 30508306, 30911684, 31236579, 31285589, 31519868, 31722674, 32089413, 32131763, 32203221, 32373223, 32913031, 32943749, 33101772, 33126883, 33404124, 33457080, 33460964, 33575321, 33579944, 33611641, 33769705, 33954872, 34106609, 34235004, 34305941, 34367732, 34434611, 34552824, 34767045, 35241494, 35382776, 35401534, 35734348, 35741779, 35801342, 35811317, 36353623, 36369379, 36614254, 36640052, 36737759, 36761750, 36788224, 36912199, 37036308, 37277193, 37343324, 37781029, 37889437, 37970473, 37993847, 38050219, 38050871, 38244710, 38307189, 39244216, 39272096, 39806853, 40275321
Systemic Vasculitis	Associate	34625602
T cell immunodeficiency primary	Associate	25427199, 26183035, 34502071
Tangier Disease	Associate	30092832
Teratoma Ovarian	Associate	30412106
Tertiary Lymphoid Structures	Associate	32963045
Testicular Germ Cell Tumor	Associate	26598537
Thoracic Neoplasms	Associate	38124509
Thrombocytopenia	Associate	35586668
Thymic epithelial tumor	Associate	27565906, 29702286
Thymoma	Associate	27565906, 29702286, 30600651, 34622229
Thyroid Cancer Papillary	Associate	28974264, 31159823, 32348468, 34465342, 36211409, 36420264, 36518249, 38457034
Thyroid Carcinoma Anaplastic	Associate	31637475, 34397868, 37122752
Thyroid Diseases	Stimulate	39355355
Thyroid Neoplasms	Associate	35388548, 37501393
Thyroiditis	Associate	32323619
Thyroiditis Autoimmune	Associate	34099659, 34494503, 36518249
Tourette Syndrome	Associate	28400429
Triple Negative Breast Neoplasms	Associate	26317899, 27138582, 27912781, 29336717, 29615063, 29996881, 30294328, 30728081, 30929569, 31836816, 32019858, 32709714, 33717059, 33918859, 34185141, 34580291, 34583980, 35337339, 35748713, 36161312, 36880837, 37390206, 37671167, 37729362, 37767092, 37924153, 38267903, 39214650, 39780116, 40613791
Trophoblastic Neoplasms	Associate	27362903
Tuberculosis	Stimulate	22713261
Tuberculosis	Associate	27924827, 30624717, 31497018, 32761425, 33570446, 34183838
Tuberculosis Meningeal	Associate	34597347
Tuberculosis Pulmonary	Associate	22713261, 35293343, 39386167
Turcot syndrome	Associate	26028255, 28596308, 31998307, 33215787, 34427115, 34667028, 34975873, 35352512, 36030556, 36301137, 36522531, 37847338, 38022513, 39530558
Urethral Neoplasms	Associate	29489427, 30653744, 31272788, 31477145, 32391189, 33098265, 33837006, 36338826, 36532083, 36945968, 37901233, 40307755
Urinary Bladder Neoplasms	Associate	24606459, 29312460, 30009527, 30400941, 30666091, 31174611, 32497499, 33064988, 33356494, 33793576, 34530089, 35029177, 35209909, 35227680, 35314433, 35768833, 35972693, 36275893, 36474424, 37151354, 37379131, 37705121, 37955535, 38015710, 39867879, 40630945
Uterine Cervical Dysplasia	Associate	23521696, 29400020, 34290992
Uterine Cervical Neoplasms	Associate	27050970, 27721577, 28075442, 29145543, 31586491, 32917410, 32964058, 33424844, 34011535, 34076351, 34848831, 35154907, 36042498, 37469254, 37938121, 38193091, 38215117, 39201462
Uterine Cervical Neoplasms	Inhibit	31274701, 37818745
Uterine Cervicitis	Associate	34290992
Uterine Neoplasms	Associate	24658839, 29472312, 36104728
Uveal melanoma	Associate	18296654, 29185395, 29581543, 29760383, 30787124, 33072070, 33262254, 34782661, 39349498
Uveomeningoencephalitic Syndrome	Associate	19234630
Vascular Remodeling	Associate	35930205
Viremia	Associate	24148296, 32194543
Virus Diseases	Stimulate	21856939, 25257362, 30911684
Virus Diseases	Associate	23288508, 25427199, 27519280, 36596303
Vitamin D Deficiency	Stimulate	36601880
Vitiligo	Associate	26957557, 31532537
Vitiligo	Stimulate	33711672
Vulvar Neoplasms	Associate	34697217, 35291960
Weight Loss	Inhibit	36482425
Wilms Tumor	Associate	30981637
Wiskott Aldrich Syndrome	Associate	37122750
Wounds and Injuries	Associate	26183035
X Linked Combined Immunodeficiency Diseases	Associate	34899684
Xeroderma Pigmentosum	Associate	36232946