Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51320
Gene name Gene Name - the full gene name approved by the HGNC.
Mex-3 RNA binding family member C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MEX3C
Synonyms (NCBI Gene) Gene synonyms aliases
BM-013, MEX-3C, RKHD2, RNF194
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18q21.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of a family of proteins with two K homology (KH) RNA-binding domains and a C-terminal RING-finger domain. The protein interacts with mRNA via the KH domains, and the protein shuttles between the nucleus and cytoplasm. Polymorphi
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016060 hsa-miR-374b-5p Sequencing 20371350
MIRT026985 hsa-miR-103a-3p Sequencing 20371350
MIRT037656 hsa-miR-744-5p CLASH 23622248
MIRT440250 ebv-miR-BART10-3p HITS-CLIP 22473208
MIRT148501 hsa-miR-155-5p HITS-CLIP 22473208
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003415 Process Chondrocyte hypertrophy IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IDA 23408853
GO:0005515 Function Protein binding IPI 22863774
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611005 28040 ENSG00000176624
Protein
UniProt ID Q5U5Q3
Protein name RNA-binding E3 ubiquitin-protein ligase MEX3C (EC 2.3.2.27) (RING finger and KH domain-containing protein 2) (RING finger protein 194) (RING-type E3 ubiquitin transferase MEX3C)
Protein function E3 ubiquitin ligase responsible for the post-transcriptional regulation of common HLA-A allotypes. Binds to the 3' UTR of HLA-A2 mRNA, and regulates its levels by promoting mRNA decay. RNA binding is sufficient to prevent translation, but ubiqui
PDB 5WWW , 5WWX , 5WWZ , 5ZI6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00013 KH_1 232 295 KH domain Domain
PF00013 KH_1 328 389 KH domain Domain
PF13920 zf-C3HC4_3 604 654 Domain
Tissue specificity TISSUE SPECIFICITY: Highest levels found in fetal brain and testis. Also expressed in thymus, salivary gland and uterus. Highly expressed in cells of the innate immune system, in particular activated NK cells. Week expression in the intestine. {ECO:000026
Sequence
MPSGSSAALALAAAPAPLPQPPPPPPPPPPPLPPPSGGPELEGDGLLLRERLAALGLDDP
SPAEPGAPALRAPAAAAQGQARRAAELSPEERAPPGRPGAPEAAELELEEDEEEGEEAEL
DGDLLEEEELEEAEEEDRSSLLLLSPPAATASQTQQIPGGSLGSVLLPAARFDAREAAAA
AAAAGVLYGGDDAQGMMAAMLSHAYGPGGCGAAAAALNGEQAALLRRKSVNTTECVPVPS
SEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPIFVVTGRKEDVAMAKREILS
AAEHF
SMIRASRNKNGPALGGLSCSPNLPGQTTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYI
VTPSRDKEPVFEVTGMPENVDRAREEIEM
HIAMRTGNYIELNEENDFHYNGTDVSFEGGT
LGSAWLSSNPVPPSRARMISNYRNDSSSSLGSGSTDSYFGSNRLADFSPTSPFSTGNFWF
GDTLPSVGSEDLAVDSPAFDSLPTSAQTIWTPFEPVNPLSGFGSDPSGNMKTQRRGSQPS
TPRLSPTFPESIEHPLARRVRSDPPSTGNHVGLPIYIPAFSNGTNSYSSSNGGSTSSSPP
ESRRKHDCVICFENEVIAALVPCGHNLFCMECANKICEKRTPSCPVCQTAVTQAIQIHS
Sequence length 659
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Antigen processing: Ubiquitination & Proteasome degradation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Arthritis Juvenile arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 19565504
Atrial fibrillation Atrial Fibrillation rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557
View all (6 more)
30061737, 29892015
Unknown
Disease term Disease name Evidence References Source
Paroxysmal atrial fibrillation Paroxysmal atrial fibrillation 29892015, 30061737 ClinVar
Atrial Fibrillation Atrial Fibrillation GWAS
Hypertension Hypertension GWAS
Insomnia Insomnia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 37828435, 39488269
Chromosomal Instability Inhibit 23446422
Colorectal Neoplasms Associate 23446422
Myocardial Infarction Associate 31698570
Neoplasm Metastasis Stimulate 32862604
Osteosarcoma Associate 32862604
Ovarian Neoplasms Associate 33896797
Tachycardia Atrioventricular Nodal Reentry Stimulate 32862604