Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51312
Gene name Gene Name - the full gene name approved by the HGNC.
Solute carrier family 25 member 37
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLC25A37
Synonyms (NCBI Gene) Gene synonyms aliases
HT015, MFRN, MFRN1, MSC, MSCP, PRO1278, PRO1584, PRO2217
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p21.2
Summary Summary of gene provided in NCBI Entrez Gene.
SLC25A37 is a solute carrier localized in the mitochondrial inner membrane. It functions as an essential iron importer for the synthesis of mitochondrial heme and iron-sulfur clusters (summary by Chen et al., 2009 [PubMed 19805291]).[supplied by OMIM, Jan
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT025959 hsa-miR-7-5p Sequencing 20371350
MIRT050876 hsa-miR-17-5p CLASH 23622248
MIRT676302 hsa-miR-582-3p HITS-CLIP 23824327
MIRT676301 hsa-miR-5571-5p HITS-CLIP 23824327
MIRT676300 hsa-miR-552-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005381 Function Iron ion transmembrane transporter activity IBA 21873635
GO:0005515 Function Protein binding IPI 32296183
GO:0005743 Component Mitochondrial inner membrane IEA
GO:0016021 Component Integral component of membrane IEA
GO:0048250 Process Iron import into the mitochondrion IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610387 29786 ENSG00000147454
Protein
UniProt ID Q9NYZ2
Protein name Mitoferrin-1 (Mitochondrial iron transporter 1) (Mitochondrial solute carrier protein) (Solute carrier family 25 member 37)
Protein function Mitochondrial iron transporter that specifically mediates iron uptake in developing erythroid cells, thereby playing an essential role in heme biosynthesis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00153 Mito_carr 41 136 Mitochondrial carrier protein Family
PF00153 Mito_carr 139 230 Mitochondrial carrier protein Family
PF00153 Mito_carr 230 331 Mitochondrial carrier protein Family
Sequence
MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSASVSTHMTAGAMAGILEH
SVMYPVDSVKTRMQSLSPDPKAQYTSIYGALKKIMRTEGFWRPLRGVNVMIMGAGPAHAM
YFACYENMKRTLNDVF
HHQGNSHLANGIAGSMATLLHDAVMNPAEVVKQRLQMYNSQHRS
AISCIRTVWRTEGLGAFYRSYTTQLTMNIPFQSIHFITYEFLQEQVNPH
RTYNPQSHIIS
GGLAGALAAAATTPLDVCKTLLNTQENVALSLANISGRLSGMANAFRTVYQLNGLAGYFK
GIQARVIYQMPSTAISWSVYEFFKYFLTKRQ
LENRAPY
Sequence length 338
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Anemia Anemia rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966
View all (89 more)
22253756
Hypothyroidism Hypothyroidism rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912
View all (22 more)
30595370
Unknown
Disease term Disease name Evidence References Source
Mental Depression Mental Depression GWAS
Prostate cancer Prostate cancer Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population. GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Anemia Refractory Associate 25955609
Carcinoma Renal Cell Associate 37304236
Coronary Artery Disease Associate 33686958
DNA Virus Infections Associate 33276460
Fatigue Associate 23047795, 24786901
Hypoxia Stimulate 19187226
Mitochondrial Diseases Associate 39337531
Neoplasms Associate 40447904
Prostatic Neoplasms Associate 23047795
Protoporphyria Erythropoietic Associate 30391163