Gene Gene information from NCBI Gene database.
Entrez ID 51303
Gene name FKBP prolyl isomerase 11
Gene symbol FKBP11
Synonyms (NCBI Gene)
FKBP19
Chromosome 12
Chromosome location 12q13.12
Summary FKBP11 belongs to the FKBP family of peptidyl-prolyl cis/trans isomerases, which catalyze the folding of proline-containing polypeptides. The peptidyl-prolyl isomerase activity of FKBP proteins is inhibited by the immunosuppressant compounds FK506 and rap
miRNA miRNA information provided by mirtarbase database.
47
miRTarBase ID miRNA Experiments Reference
MIRT997156 hsa-miR-1825 CLIP-seq
MIRT997157 hsa-miR-199a-5p CLIP-seq
MIRT997158 hsa-miR-199b-5p CLIP-seq
MIRT997159 hsa-miR-4436b-3p CLIP-seq
MIRT997156 hsa-miR-1825 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
GO ID Ontology Definition Evidence Reference
GO:0003755 Function Peptidyl-prolyl cis-trans isomerase activity IBA
GO:0003755 Function Peptidyl-prolyl cis-trans isomerase activity IEA
GO:0005783 Component Endoplasmic reticulum IBA
GO:0016020 Component Membrane HDA 19946888
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610571 18624 ENSG00000134285
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NYL4
Protein name Peptidyl-prolyl cis-trans isomerase FKBP11 (PPIase FKBP11) (EC 5.2.1.8) (19 kDa FK506-binding protein) (19 kDa FKBP) (FKBP-19) (FK506-binding protein 11) (FKBP-11) (Rotamase)
Protein function PPIases accelerate the folding of proteins during protein synthesis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00254 FKBP_C 50 141 FKBP-type peptidyl-prolyl cis-trans isomerase Domain
Sequence
MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTL
HIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYG
KRGFPPSVPADAVVQYDVELI
ALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKA
NRPKVSKKKLKEEKRNKSKKK
Sequence length 201
Interactions View interactions