CYP39A1 (cytochrome P450 family 39 subfamily A member 1)

Gene

• Entrez ID: 51302
• Gene name: Cytochrome P450 family 39 subfamily A member 1
• Gene symbol: CYP39A1
• Synonyms (NCBI Gene): -
• Chromosome: 6
• Chromosome location: 6p12.3
• Summary: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic r

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018738	hsa-miR-335-5p	Microarray	18185580
MIRT021447	hsa-miR-9-5p	Microarray	17612493
MIRT921464	hsa-miR-186	CLIP-seq
MIRT921465	hsa-miR-18a	CLIP-seq
MIRT921466	hsa-miR-18b	CLIP-seq
MIRT921467	hsa-miR-3133	CLIP-seq
MIRT921468	hsa-miR-3607-3p	CLIP-seq
MIRT921469	hsa-miR-3664-5p	CLIP-seq
MIRT921470	hsa-miR-3686	CLIP-seq
MIRT921471	hsa-miR-4714-5p	CLIP-seq
MIRT921472	hsa-miR-4735-3p	CLIP-seq
MIRT2386663	hsa-miR-3609	CLIP-seq
MIRT2386664	hsa-miR-4302	CLIP-seq
MIRT2386665	hsa-miR-4519	CLIP-seq
MIRT2386666	hsa-miR-520g	CLIP-seq
MIRT2386667	hsa-miR-520h	CLIP-seq
MIRT2386668	hsa-miR-548ah	CLIP-seq
MIRT2512484	hsa-miR-1291	CLIP-seq
MIRT2512485	hsa-miR-4493	CLIP-seq
MIRT2512486	hsa-miR-4691-5p	CLIP-seq
MIRT2512487	hsa-miR-483-3p	CLIP-seq
MIRT2512484	hsa-miR-1291	CLIP-seq
MIRT2512485	hsa-miR-4493	CLIP-seq
MIRT2512486	hsa-miR-4691-5p	CLIP-seq
MIRT2512487	hsa-miR-483-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005506	Function	Iron ion binding	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006699	Process	Bile acid biosynthetic process	IBA	21873635
GO:0006699	Process	Bile acid biosynthetic process	IDA	10748047
GO:0006699	Process	Bile acid biosynthetic process	IEA
GO:0006699	Process	Bile acid biosynthetic process	TAS
GO:0006707	Process	Cholesterol catabolic process	IEA
GO:0007586	Process	Digestion	TAS	10748047
GO:0008387	Function	Steroid 7-alpha-hydroxylase activity	IBA	21873635
GO:0008395	Function	Steroid hydroxylase activity	IBA	21873635
GO:0008396	Function	Oxysterol 7-alpha-hydroxylase activity	IBA	21873635
GO:0008396	Function	Oxysterol 7-alpha-hydroxylase activity	IDA	10748047
GO:0008396	Function	Oxysterol 7-alpha-hydroxylase activity	TAS
GO:0016021	Component	Integral component of membrane	IEA
GO:0016125	Process	Sterol metabolic process	TAS
GO:0020037	Function	Heme binding	IEA
GO:0042632	Process	Cholesterol homeostasis	IBA	21873635
GO:0043231	Component	Intracellular membrane-bounded organelle	TAS	10748047

Other IDs

• MIM: 605994
• HGNC: 17449
• e!Ensembl: ENSG00000146233

Protein

• UniProt ID: Q9NYL5
• Protein name: 24-hydroxycholesterol 7-alpha-hydroxylase (EC 1.14.14.26) (Cytochrome P450 39A1) (hCYP39A1) (Oxysterol 7-alpha-hydroxylase)
• Protein function: A cytochrome P450 monooxygenase involved in neural cholesterol clearance through bile acid synthesis (PubMed:10748047, PubMed:25201972). Catalyzes 7-alpha hydroxylation of (24S)-hydroxycholesterol, a neural oxysterol that is metabolized to bile
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00067	p450	29 → 463	Cytochrome P450	Domain

• Tissue specificity: TISSUE SPECIFICITY: Liver specific. {ECO:0000269|PubMed:10748047}.
• Sequence:

  MELISPTVIIILGCLALFLLLQRKNLRRPPCIKGWIPWIGVGFEFGKAPLEFIEKARIKY
  GPIFTVFAMGNRMTFVTEEEGINVFLKSKKVDFELAVQNIVYRTASIPKNVFLALHEKLY
  IMLKGKMGTVNLHQFTGQLTEELHEQLENLGTHGTMDLNNLVRHLLYPVTVNMLFNKSLF
  STNKKKIKEFHQYFQVYDEDFEYGSQLPECLLRNWSKSKKWFLELFEKNIPDIKACKSAK
  DNSMTLLQATLDIVETETSKENSPNYGLLLLWASLSNAVPVAFWTLAYVLSHPDIHKAIM
  EGISSVFGKAGKDKIKVSEDDLENLLLIKWCVLETIRLKAPGVITRKVVKPVEILNYIIP
  SGDLLMLSPFWLHRNPKYFPEPELFKPERWKKANLEKHSFLDCFMAFGSGKFQCPARWFA
  LLEVQMCIILILYKYDCSLLDPLPKQSYLHLVGVPQPEGQCRIEYKQRI

• Sequence length: 469

Pathways

KEGG:

Primary bile acid biosynthesis

Reactome:

Synthesis of bile acids and bile salts via 24-hydroxycholesterol
Endogenous sterols