Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51300
Gene name Gene Name - the full gene name approved by the HGNC.
Translocase of inner mitochondrial membrane domain containing 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TIMMDC1
Synonyms (NCBI Gene) Gene synonyms aliases
C3orf1, MC1DN31
Disease Acronyms (UniProt) Disease acronyms from UniProt database
MC1DN31
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q13.33
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs370482859 C>T Likely-pathogenic Coding sequence variant, intron variant, missense variant
rs781525096 A>G Pathogenic Intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT050760 hsa-miR-17-3p CLASH 23622248
MIRT526361 hsa-miR-4323 PAR-CLIP 22012620
MIRT526359 hsa-miR-3189-5p PAR-CLIP 22012620
MIRT526361 hsa-miR-4323 PAR-CLIP 22012620
MIRT526359 hsa-miR-3189-5p PAR-CLIP 22012620
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 31515488, 32296183
GO:0005654 Component Nucleoplasm IDA
GO:0005739 Component Mitochondrion IBA 21873635
GO:0005739 Component Mitochondrion IDA
GO:0005743 Component Mitochondrial inner membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
615534 1321 ENSG00000113845
Protein
UniProt ID Q9NPL8
Protein name Complex I assembly factor TIMMDC1, mitochondrial (Protein M5-14) (Translocase of inner mitochondrial membrane domain-containing protein 1) (TIMM domain containing-protein 1)
Protein function Chaperone protein involved in the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). Participates in constructing the membrane arm of complex I.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02466 Tim17 77 199 Family
Tissue specificity TISSUE SPECIFICITY: Generalized expression enhanced in heart and skeletal muscle. {ECO:0000269|PubMed:11092749}.
Sequence
MEVPPPAPRSFLCRALCLFPRVFAAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRE
LFGKDEQQRISKDLANICKTAATAGIIGWVYGGIPAFIHAKQQYIEQSQAEIYHNRFDAV
QSAHRAATRGFIRYGWRWGWRTAVFVTIFNTVNTSLNVYRNKDALSHFVIAGAVTGSLFR
INVGLRGLVAGGIIGALLG
TPVGGLLMAFQKYSGETVQERKQKDRKALHELKLEEWKGRL
QVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDKD
Sequence length 285
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Complex I biogenesis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Arthritis Systemic onset juvenile chronic arthritis, Juvenile arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 23603761, 22354554
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Diabetes mellitus Diabetes Mellitus rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)
Epileptic encephalopathy Encephalopathies rs587776508, rs121918334, rs121918317, rs121918321, rs74315390, rs28939684, rs74315391, rs74315392, rs118192244, rs121918622, rs121918623, rs121917953, rs121917955, rs121918624, rs121918625
View all (860 more)
Unknown
Disease term Disease name Evidence References Source
Ptosis Blepharoptosis, Ptosis ClinVar
Mitochondrial Complex Deficiency mitochondrial complex 1 deficiency, nuclear type 31, mitochondrial complex I deficiency GenCC
Leigh Syndrome Leigh syndrome GenCC
Biliary Cholangitis Biliary Cholangitis GWAS
Associations from Text Mining
Disease Name Relationship Type References
Asthma Stimulate 40409178
Cardiomyopathies Associate 38291374
Immunoglobulin G4 Related Disease Associate 33278652
Leigh Disease Associate 30981218
Liver Cirrhosis Biliary Associate 25690649, 30643196
Lung Neoplasms Associate 25391042
Mitochondrial complex I deficiency Associate 24344204, 33278652
Mitochondrial Diseases Associate 33278652
Myopathy with Giant Abnormal Mitochondria Associate 38291374