Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5130
Gene name Gene Name - the full gene name approved by the HGNC.
Phosphate cytidylyltransferase 1A, choline
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PCYT1A
Synonyms (NCBI Gene) Gene synonyms aliases
CCTA, CCTalpha, CGL5, CT, CTA, CTPCT, PCYT1, SMDCRD
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q29
Summary Summary of gene provided in NCBI Entrez Gene.
This gene belongs to the cytidylyltransferase family and is involved in the regulation of phosphatidylcholine biosynthesis. Mutations in this gene are associated with spondylometaphyseal dysplasia with cone-rod dystrophy. Alternatively spliced transcript
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs540053239 C>G,T Pathogenic Synonymous variant, missense variant, coding sequence variant
rs587777189 G>A Pathogenic Missense variant, coding sequence variant
rs587777190 G>C Pathogenic Missense variant, coding sequence variant
rs587777191 C>T Pathogenic Missense variant, coding sequence variant
rs587777192 G>A,T Pathogenic Stop gained, coding sequence variant, synonymous variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT032475 hsa-let-7b-5p Proteomics 18668040
MIRT050150 hsa-miR-26a-5p CLASH 23622248
MIRT719105 hsa-miR-520g-3p HITS-CLIP 19536157
MIRT719104 hsa-miR-520h HITS-CLIP 19536157
MIRT719103 hsa-miR-1226-3p HITS-CLIP 19536157
Transcription factors
Transcription factor Regulation Reference
ZNF143 Activation 14702349
ZNF76 Activation 14702349
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003824 Function Catalytic activity IEA
GO:0004105 Function Choline-phosphate cytidylyltransferase activity IBA
GO:0004105 Function Choline-phosphate cytidylyltransferase activity IDA 10480912
GO:0004105 Function Choline-phosphate cytidylyltransferase activity IEA
GO:0004105 Function Choline-phosphate cytidylyltransferase activity ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
123695 8754 ENSG00000161217
Protein
UniProt ID P49585
Protein name Choline-phosphate cytidylyltransferase A (EC 2.7.7.15) (CCT-alpha) (CTP:phosphocholine cytidylyltransferase A) (CCT A) (CT A) (Phosphorylcholine transferase A)
Protein function Catalyzes the key rate-limiting step in the CDP-choline pathway for phosphatidylcholine biosynthesis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01467 CTP_transf_like 80 208 Cytidylyltransferase-like Domain
Tissue specificity TISSUE SPECIFICITY: Brain, placenta, liver, fetal and adult lung. {ECO:0000269|PubMed:10480912}.
Sequence
MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYV
RVTMEEASRGTPCERPVRVYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHN
FKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDD
VYKHIKEAGMFAPTQRTEGISTSDIITR
IVRDYDVYARRNLQRGYTAKELNVSFINEKKY
HLQERVDKVKKKVKDVEEKSKEFVQKVEEKSIDLIQKWEEKSREFIGSFLEMFGPEGALK
HMLKEGKGRMLQAISPKQSPSSSPTRERSPSPSFRWPFSGKTSPPCSPANLSRHKAAAYD
ISEDEED
Sequence length 367
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Phosphonate and phosphinate metabolism
Glycerophospholipid metabolism
Metabolic pathways
Choline metabolism in cancer
  Synthesis of PC
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Spondylometaphyseal Dysplasia With Cone-Rod Dystrophy spondylometaphyseal dysplasia-cone-rod dystrophy syndrome rs587777189, rs587777190, rs587777191, rs540053239, rs587777194, rs587777195 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Leber Congenital Amaurosis leber congenital amaurosis, Leber congenital amaurosis N/A N/A ClinVar, GenCC
retinal dystrophy Retinal dystrophy N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Bone Diseases Developmental Associate 29122926
Carcinoma Non Small Cell Lung Associate 24692084
Carcinoma Squamous Cell Associate 24692084
Cone Rod Dystrophies Associate 24387991, 28272537
Eye Abnormalities Associate 29122926
Fatty Liver Associate 28272537
Lipodystrophy Associate 28272537
Lung Neoplasms Associate 23171216
Lymphatic Metastasis Stimulate 31413263
Lymphoma Associate 28686226