Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51299
Gene name	Neuritin 1
Gene symbol	NRN1
Synonyms (NCBI Gene)	NRNdJ380B8.2
Chromosome	6
Chromosome location	6p25.1
Summary	This gene encodes a member of the neuritin family, and is expressed in postmitotic-differentiating neurons of the developmental nervous system and neuronal structures associated with plasticity in the adult. The expression of this gene can be induced by n

Show/Hide all (93)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028913	hsa-miR-26b-5p	Microarray	19088304
MIRT050310	hsa-miR-25-3p	CLASH	23622248
MIRT049996	hsa-miR-28-5p	CLASH	23622248
MIRT626909	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT626908	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT626907	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT626906	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT626905	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT626909	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT626908	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT626907	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT626906	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT626905	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT626909	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT626908	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT626907	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT626906	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT626905	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT626909	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT626908	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT626907	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT626906	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT626905	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT626909	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT626908	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT626907	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT626906	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT626905	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT626909	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT626908	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT626907	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT626906	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT626905	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT626909	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT626908	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT626907	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT626906	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT626905	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT626909	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT626908	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT626907	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT626906	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT626905	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT626909	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT626908	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT626907	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT626906	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT626905	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT626909	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT626908	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT626907	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT626906	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT626905	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT1194313	hsa-miR-103a	CLIP-seq
MIRT1194314	hsa-miR-107	CLIP-seq
MIRT1194315	hsa-miR-129-5p	CLIP-seq
MIRT1194316	hsa-miR-15a	CLIP-seq
MIRT1194317	hsa-miR-15b	CLIP-seq
MIRT1194318	hsa-miR-16	CLIP-seq
MIRT1194319	hsa-miR-195	CLIP-seq
MIRT1194320	hsa-miR-3123	CLIP-seq
MIRT1194321	hsa-miR-3129-3p	CLIP-seq
MIRT1194322	hsa-miR-3133	CLIP-seq
MIRT1194323	hsa-miR-3659	CLIP-seq
MIRT1194324	hsa-miR-3919	CLIP-seq
MIRT1194325	hsa-miR-424	CLIP-seq
MIRT1194326	hsa-miR-4276	CLIP-seq
MIRT1194327	hsa-miR-4291	CLIP-seq
MIRT1194328	hsa-miR-4310	CLIP-seq
MIRT1194329	hsa-miR-4511	CLIP-seq
MIRT1194330	hsa-miR-4524	CLIP-seq
MIRT1194331	hsa-miR-4680-3p	CLIP-seq
MIRT1194332	hsa-miR-4775	CLIP-seq
MIRT1194333	hsa-miR-497	CLIP-seq
MIRT1194334	hsa-miR-503	CLIP-seq
MIRT1194335	hsa-miR-591	CLIP-seq
MIRT1194336	hsa-miR-628-5p	CLIP-seq
MIRT1194337	hsa-miR-646	CLIP-seq
MIRT2056404	hsa-miR-1284	CLIP-seq
MIRT2056405	hsa-miR-4684-5p	CLIP-seq
MIRT1194315	hsa-miR-129-5p	CLIP-seq
MIRT1194320	hsa-miR-3123	CLIP-seq
MIRT1194323	hsa-miR-3659	CLIP-seq
MIRT2284933	hsa-miR-374a	CLIP-seq
MIRT2284934	hsa-miR-374b	CLIP-seq
MIRT1194324	hsa-miR-3919	CLIP-seq
MIRT1194327	hsa-miR-4291	CLIP-seq
MIRT1194328	hsa-miR-4310	CLIP-seq
MIRT2284935	hsa-miR-4658	CLIP-seq
MIRT1194331	hsa-miR-4680-3p	CLIP-seq
MIRT1194332	hsa-miR-4775	CLIP-seq
MIRT2284936	hsa-miR-574-5p	CLIP-seq
MIRT1194336	hsa-miR-628-5p	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007399	Process	Nervous system development	IEA
GO:0016020	Component	Membrane	IEA
GO:0032281	Component	AMPA glutamate receptor complex	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0045202	Component	Synapse	IEA
GO:0090128	Process	Regulation of synapse maturation	IEA
GO:0098552	Component	Side of membrane	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA
GO:1990138	Process	Neuron projection extension	IBA
GO:1990138	Process	Neuron projection extension	IEA

MIM	HGNC	e!Ensembl
607409	17972	ENSG00000124785

Q9NPD7

Protein name

Neuritin

Protein function

Promotes neurite outgrowth and especially branching of neuritic processes in primary hippocampal and cortical cells.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15056	NRN1	31 → 117	Neuritin protein family	Domain

Sequence

MGLKLNGRYISLILAVQIAYLVQAVRAAGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKT
NIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGNGAAGS
LLPAFPVLLVSLSAALATWLSF

Sequence length

142

Interactions

View interactions

	Reactome
			Post-translational modification: synthesis of GPI-anchored proteins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIAC EMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOEMBOLIC STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (20)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Acute Kidney Injury	Associate	33863396	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	37024090	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Associate	26700405	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Associate	37185612	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Associate	38165375	★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Associate	19723343	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss	Associate	34530960	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss Noise Induced	Associate	34530960	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Stimulate	16723126	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia Brain	Associate	16723126	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Inhibit	33787845	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	27901477	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	16723126	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nerve Degeneration	Inhibit	37024090	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	27768648	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Associate	31491902	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	31775891	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Associate	26700405	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia Spectrum and Other Psychotic Disorders	Associate	26700405	★★★★★ ★☆☆☆☆ Found in Text Mining only
Shock Septic	Associate	33863396	★★★★★ ★☆☆☆☆ Found in Text Mining only

NRN1 (neuritin 1)