Gene Gene information from NCBI Gene database.
Entrez ID 51293
Gene name CD320 molecule
Gene symbol CD320
Synonyms (NCBI Gene)
8D68D6ATCBLRTCII-RTCN2RsCD320
Chromosome 19
Chromosome location 19p13.2
Summary This gene encodes the transcobalamin receptor that is expressed at the cell surface. It mediates the cellular uptake of transcobalamin bound cobalamin (vitamin B12), and is involved in B-cell proliferation and immunoglobulin secretion. Mutations in this g
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs150384171 CTC>- Uncertain-significance, conflicting-interpretations-of-pathogenicity, benign-likely-benign, other Coding sequence variant, inframe deletion, intron variant
miRNA miRNA information provided by mirtarbase database.
20
miRTarBase ID miRNA Experiments Reference
MIRT045905 hsa-miR-125b-5p CLASH 23622248
MIRT040769 hsa-miR-18a-3p CLASH 23622248
MIRT1959467 hsa-miR-302f CLIP-seq
MIRT1959468 hsa-miR-3064-3p CLIP-seq
MIRT1959469 hsa-miR-4715-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IDA 27411955
GO:0005515 Function Protein binding IPI 27411955
GO:0005783 Component Endoplasmic reticulum IDA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IDA 10727470, 18779389
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606475 16692 ENSG00000167775
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NPF0
Protein name CD320 antigen (8D6 antigen) (FDC-signaling molecule 8D6) (FDC-SM-8D6) (Transcobalamin receptor) (TCblR) (CD antigen CD320)
Protein function Receptor for transcobalamin saturated with cobalamin (TCbl) (PubMed:18779389). Plays an important role in cobalamin uptake (PubMed:18779389, PubMed:20524213). Plasma membrane protein that is expressed on follicular dendritic cells (FDC) and medi
PDB 4ZRP , 4ZRQ , 7QBD , 7QBE , 7QBF , 7QBG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00057 Ldl_recept_a 52 89 Low-density lipoprotein receptor domain class A Repeat
PF00057 Ldl_recept_a 130 167 Low-density lipoprotein receptor domain class A Repeat
Tissue specificity TISSUE SPECIFICITY: Detected in the germinal center (GC) of lymphoid follicles (at protein level) (PubMed:11418631). Expressed abundantly on follicular dendritic cells (FDCs) (PubMed:10727470). {ECO:0000269|PubMed:10727470, ECO:0000269|PubMed:11418631}.
Sequence
MSGGWMAQVGAWRTGALGLALLLLLGLGLGLEAAASPLSTPTSAQAAGPSSGSCPPTKFQ
CRTSGLCVPLTWRCDRDLDCSDGSDEEEC
RIEPCTQKGQCPPPPGLPCPCTGVSDCSGGT
DKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATT
MGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVIAAAAVLSA
SLVTATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTSLP
Sequence length 282
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cobalamin transport and metabolism   Cobalamin (Cbl, vitamin B12) transport and metabolism
Defective CD320 causes methylmalonic aciduria
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
22
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Adrenocortical carcinoma, hereditary Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CD320-related disorder Conflicting classifications of pathogenicity; other; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Drug Related Side Effects and Adverse Reactions Associate 20858723
★☆☆☆☆
Found in Text Mining only
Encephalitis Associate 28935853
★☆☆☆☆
Found in Text Mining only
Fever Associate 28935853
★☆☆☆☆
Found in Text Mining only
Infertility Associate 21857689
★☆☆☆☆
Found in Text Mining only
Infertility Male Associate 21857689
★☆☆☆☆
Found in Text Mining only
Methylmalonic acidemia Associate 20524213
★☆☆☆☆
Found in Text Mining only
Neoplasms Associate 20858723
★☆☆☆☆
Found in Text Mining only
Neural Tube Defects Associate 20577008, 25948668
★☆☆☆☆
Found in Text Mining only
Osteoporosis Associate 32498429
★☆☆☆☆
Found in Text Mining only
Osteoporosis Stimulate 32498429
★☆☆☆☆
Found in Text Mining only