Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51284
Gene name	Toll like receptor 7
Gene symbol	TLR7
Synonyms (NCBI Gene)	IMD74SLEB17TLR7-like
Chromosome	X
Chromosome location	Xp22.2
Summary	The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and func

298

Show/Hide all (298)

miRTarBase ID	miRNA	Experiments	Reference
MIRT438602	hsa-miR-758-3p	Luciferase reporter assayWestern blotqRT-PCR	25008898
MIRT438602	hsa-miR-758-3p	Luciferase reporter assayWestern blotqRT-PCR	25008898
MIRT684099	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT684098	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT684097	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT684096	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT684095	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT684094	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT684093	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT684092	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT684091	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT684090	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT684089	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT684088	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT684087	hsa-miR-302e	HITS-CLIP	23313552
MIRT684086	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT684085	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT684084	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT684083	hsa-miR-520b	HITS-CLIP	23313552
MIRT684082	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT684081	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT684080	hsa-miR-520e	HITS-CLIP	23313552
MIRT684079	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT684078	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT684077	hsa-miR-520h	HITS-CLIP	23313552
MIRT684076	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT684074	hsa-miR-1234-3p	HITS-CLIP	23313552
MIRT684073	hsa-miR-7107-5p	HITS-CLIP	23313552
MIRT684072	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT684071	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT684070	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT684069	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT684068	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT684067	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT684066	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT684065	hsa-miR-1228-3p	HITS-CLIP	23313552
MIRT684099	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT684098	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT684097	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT684096	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT684095	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT684094	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT684093	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT684092	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT684091	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT684090	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT684089	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT684088	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT684087	hsa-miR-302e	HITS-CLIP	23313552
MIRT684086	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT684085	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT684084	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT684083	hsa-miR-520b	HITS-CLIP	23313552
MIRT684082	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT684081	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT684080	hsa-miR-520e	HITS-CLIP	23313552
MIRT684079	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT684078	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT684077	hsa-miR-520h	HITS-CLIP	23313552
MIRT684076	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT684075	hsa-miR-6747-3p	HITS-CLIP	23313552
MIRT684074	hsa-miR-1234-3p	HITS-CLIP	23313552
MIRT684073	hsa-miR-7107-5p	HITS-CLIP	23313552
MIRT684072	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT684071	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT684070	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT684069	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT684068	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT684067	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT684066	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT684065	hsa-miR-1228-3p	HITS-CLIP	23313552
MIRT449487	hsa-miR-8087	PAR-CLIP	22100165
MIRT449486	hsa-miR-586	PAR-CLIP	22100165
MIRT684097	hsa-miR-17-5p	Luciferase reporter assay	26041742
MIRT734567	hsa-let-7b-3p	qRT-PCRFlow cytometry	33079387
MIRT735682	hsa-miR-132-5p	Immunofluorescence	31940779
MIRT736103	hsa-let-7a-3p	Microarray	31540501
MIRT684099	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT684098	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT684097	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT684096	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT684095	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT684094	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT684093	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT684092	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT684091	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT684090	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT684089	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT684088	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT684087	hsa-miR-302e	HITS-CLIP	23313552
MIRT684086	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT684085	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT684084	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT684083	hsa-miR-520b	HITS-CLIP	23313552
MIRT684082	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT684081	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT684080	hsa-miR-520e	HITS-CLIP	23313552
MIRT684079	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT684078	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT684077	hsa-miR-520h	HITS-CLIP	23313552
MIRT684076	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT684074	hsa-miR-1234-3p	HITS-CLIP	23313552
MIRT684073	hsa-miR-7107-5p	HITS-CLIP	23313552
MIRT684072	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT684071	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT684070	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT684069	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT684068	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT684067	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT684066	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT684065	hsa-miR-1228-3p	HITS-CLIP	23313552
MIRT684099	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT684098	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT684097	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT684096	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT684095	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT684094	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT684093	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT684092	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT684091	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT684090	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT684089	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT684088	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT684087	hsa-miR-302e	HITS-CLIP	23313552
MIRT684086	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT684085	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT684084	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT684083	hsa-miR-520b	HITS-CLIP	23313552
MIRT684082	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT684081	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT684080	hsa-miR-520e	HITS-CLIP	23313552
MIRT684079	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT684078	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT684077	hsa-miR-520h	HITS-CLIP	23313552
MIRT684076	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT684075	hsa-miR-6747-3p	HITS-CLIP	23313552
MIRT684074	hsa-miR-1234-3p	HITS-CLIP	23313552
MIRT684073	hsa-miR-7107-5p	HITS-CLIP	23313552
MIRT684072	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT684071	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT684070	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT684069	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT684068	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT684067	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT684066	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT684065	hsa-miR-1228-3p	HITS-CLIP	23313552
MIRT449487	hsa-miR-8087	PAR-CLIP	22100165
MIRT449486	hsa-miR-586	PAR-CLIP	22100165
MIRT755537	hsa-miR-146a-5p	Luciferase reporter assayWestern blottingFlow cytometryELISA	34808293
MIRT755537	hsa-miR-146a-5p	Western blottingqRT-PCR	36210830
MIRT1427013	hsa-miR-1267	CLIP-seq
MIRT1427014	hsa-miR-1307	CLIP-seq
MIRT1427015	hsa-miR-150	CLIP-seq
MIRT1427016	hsa-miR-1912	CLIP-seq
MIRT1427017	hsa-miR-1976	CLIP-seq
MIRT1427018	hsa-miR-3136-3p	CLIP-seq
MIRT1427019	hsa-miR-3688-3p	CLIP-seq
MIRT1427020	hsa-miR-4269	CLIP-seq
MIRT1427021	hsa-miR-4275	CLIP-seq
MIRT1427022	hsa-miR-4279	CLIP-seq
MIRT1427023	hsa-miR-4284	CLIP-seq
MIRT1427024	hsa-miR-4422	CLIP-seq
MIRT1427025	hsa-miR-4438	CLIP-seq
MIRT1427026	hsa-miR-4532	CLIP-seq
MIRT1427027	hsa-miR-4638-5p	CLIP-seq
MIRT1427028	hsa-miR-4652-3p	CLIP-seq
MIRT1427029	hsa-miR-4690-5p	CLIP-seq
MIRT1427030	hsa-miR-4715-3p	CLIP-seq
MIRT1427031	hsa-miR-4722-3p	CLIP-seq
MIRT1427032	hsa-miR-4778-3p	CLIP-seq
MIRT1427033	hsa-miR-488	CLIP-seq
MIRT1427034	hsa-miR-495	CLIP-seq
MIRT1427035	hsa-miR-498	CLIP-seq
MIRT1427036	hsa-miR-5095	CLIP-seq
MIRT1427037	hsa-miR-562	CLIP-seq
MIRT1427038	hsa-miR-659	CLIP-seq
MIRT1427039	hsa-miR-944	CLIP-seq
MIRT1427014	hsa-miR-1307	CLIP-seq
MIRT2127929	hsa-miR-197	CLIP-seq
MIRT2127930	hsa-miR-3149	CLIP-seq
MIRT2127931	hsa-miR-3187-3p	CLIP-seq
MIRT2127932	hsa-miR-3663-5p	CLIP-seq
MIRT2127933	hsa-miR-371-5p	CLIP-seq
MIRT2127934	hsa-miR-371b-5p	CLIP-seq
MIRT1427023	hsa-miR-4284	CLIP-seq
MIRT2127935	hsa-miR-4435	CLIP-seq
MIRT1427025	hsa-miR-4438	CLIP-seq
MIRT2127936	hsa-miR-4463	CLIP-seq
MIRT2127937	hsa-miR-4494	CLIP-seq
MIRT1427027	hsa-miR-4638-5p	CLIP-seq
MIRT2127938	hsa-miR-4701-5p	CLIP-seq
MIRT1427030	hsa-miR-4715-3p	CLIP-seq
MIRT2127939	hsa-miR-4716-5p	CLIP-seq
MIRT2127940	hsa-miR-4735-5p	CLIP-seq
MIRT2127941	hsa-miR-4775	CLIP-seq
MIRT2127942	hsa-miR-4781-3p	CLIP-seq
MIRT1427036	hsa-miR-5095	CLIP-seq
MIRT2127943	hsa-miR-5096	CLIP-seq
MIRT2127944	hsa-miR-548s	CLIP-seq
MIRT2127945	hsa-miR-588	CLIP-seq
MIRT2127946	hsa-miR-590-3p	CLIP-seq
MIRT2127947	hsa-miR-640	CLIP-seq
MIRT1427014	hsa-miR-1307	CLIP-seq
MIRT1427015	hsa-miR-150	CLIP-seq
MIRT2127929	hsa-miR-197	CLIP-seq
MIRT2127930	hsa-miR-3149	CLIP-seq
MIRT2127931	hsa-miR-3187-3p	CLIP-seq
MIRT2349566	hsa-miR-338-3p	CLIP-seq
MIRT1427020	hsa-miR-4269	CLIP-seq
MIRT1427023	hsa-miR-4284	CLIP-seq
MIRT2127935	hsa-miR-4435	CLIP-seq
MIRT1427025	hsa-miR-4438	CLIP-seq
MIRT2127936	hsa-miR-4463	CLIP-seq
MIRT2127937	hsa-miR-4494	CLIP-seq
MIRT2349567	hsa-miR-4530	CLIP-seq
MIRT1427027	hsa-miR-4638-5p	CLIP-seq
MIRT2349568	hsa-miR-4659a-3p	CLIP-seq
MIRT2349569	hsa-miR-4659b-3p	CLIP-seq
MIRT2349570	hsa-miR-4691-5p	CLIP-seq
MIRT2349571	hsa-miR-4695-3p	CLIP-seq
MIRT2127938	hsa-miR-4701-5p	CLIP-seq
MIRT2349572	hsa-miR-4713-5p	CLIP-seq
MIRT1427030	hsa-miR-4715-3p	CLIP-seq
MIRT2127939	hsa-miR-4716-5p	CLIP-seq
MIRT2127940	hsa-miR-4735-5p	CLIP-seq
MIRT2127941	hsa-miR-4775	CLIP-seq
MIRT2127942	hsa-miR-4781-3p	CLIP-seq
MIRT2349573	hsa-miR-483-5p	CLIP-seq
MIRT1427036	hsa-miR-5095	CLIP-seq
MIRT2127943	hsa-miR-5096	CLIP-seq
MIRT2349574	hsa-miR-532-3p	CLIP-seq
MIRT2127944	hsa-miR-548s	CLIP-seq
MIRT1427037	hsa-miR-562	CLIP-seq
MIRT2127945	hsa-miR-588	CLIP-seq
MIRT2127946	hsa-miR-590-3p	CLIP-seq
MIRT2127947	hsa-miR-640	CLIP-seq
MIRT2349575	hsa-miR-766	CLIP-seq
MIRT2349576	hsa-miR-942	CLIP-seq
MIRT1427015	hsa-miR-150	CLIP-seq
MIRT1427017	hsa-miR-1976	CLIP-seq
MIRT1427020	hsa-miR-4269	CLIP-seq
MIRT1427022	hsa-miR-4279	CLIP-seq
MIRT1427025	hsa-miR-4438	CLIP-seq
MIRT1427026	hsa-miR-4532	CLIP-seq
MIRT1427030	hsa-miR-4715-3p	CLIP-seq
MIRT1427031	hsa-miR-4722-3p	CLIP-seq
MIRT1427035	hsa-miR-498	CLIP-seq
MIRT1427036	hsa-miR-5095	CLIP-seq
MIRT1427037	hsa-miR-562	CLIP-seq
MIRT1427015	hsa-miR-150	CLIP-seq
MIRT1427017	hsa-miR-1976	CLIP-seq
MIRT2127930	hsa-miR-3149	CLIP-seq
MIRT1427022	hsa-miR-4279	CLIP-seq
MIRT1427026	hsa-miR-4532	CLIP-seq
MIRT1427030	hsa-miR-4715-3p	CLIP-seq
MIRT1427031	hsa-miR-4722-3p	CLIP-seq
MIRT2127940	hsa-miR-4735-5p	CLIP-seq
MIRT2127941	hsa-miR-4775	CLIP-seq
MIRT2349573	hsa-miR-483-5p	CLIP-seq
MIRT1427035	hsa-miR-498	CLIP-seq
MIRT2127946	hsa-miR-590-3p	CLIP-seq
MIRT2643094	hsa-miR-101	CLIP-seq
MIRT2643095	hsa-miR-1261	CLIP-seq
MIRT2643096	hsa-miR-144	CLIP-seq
MIRT1427015	hsa-miR-150	CLIP-seq
MIRT1427017	hsa-miR-1976	CLIP-seq
MIRT2127930	hsa-miR-3149	CLIP-seq
MIRT1427020	hsa-miR-4269	CLIP-seq
MIRT1427022	hsa-miR-4279	CLIP-seq
MIRT1427025	hsa-miR-4438	CLIP-seq
MIRT1427026	hsa-miR-4532	CLIP-seq
MIRT1427030	hsa-miR-4715-3p	CLIP-seq
MIRT1427031	hsa-miR-4722-3p	CLIP-seq
MIRT2127940	hsa-miR-4735-5p	CLIP-seq
MIRT2127941	hsa-miR-4775	CLIP-seq
MIRT2349573	hsa-miR-483-5p	CLIP-seq
MIRT1427035	hsa-miR-498	CLIP-seq
MIRT1427036	hsa-miR-5095	CLIP-seq
MIRT1427037	hsa-miR-562	CLIP-seq
MIRT2127946	hsa-miR-590-3p	CLIP-seq
MIRT2693231	hsa-miR-1323	CLIP-seq
MIRT1427015	hsa-miR-150	CLIP-seq
MIRT1427017	hsa-miR-1976	CLIP-seq
MIRT2127930	hsa-miR-3149	CLIP-seq
MIRT1427020	hsa-miR-4269	CLIP-seq
MIRT1427022	hsa-miR-4279	CLIP-seq
MIRT1427025	hsa-miR-4438	CLIP-seq
MIRT1427026	hsa-miR-4532	CLIP-seq
MIRT1427030	hsa-miR-4715-3p	CLIP-seq
MIRT1427031	hsa-miR-4722-3p	CLIP-seq
MIRT2127940	hsa-miR-4735-5p	CLIP-seq
MIRT2127941	hsa-miR-4775	CLIP-seq
MIRT1427035	hsa-miR-498	CLIP-seq
MIRT1427036	hsa-miR-5095	CLIP-seq
MIRT2693232	hsa-miR-548aa	CLIP-seq
MIRT2693233	hsa-miR-548o	CLIP-seq
MIRT1427037	hsa-miR-562	CLIP-seq
MIRT2127946	hsa-miR-590-3p	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
NFKB1	Activation	16423052;20658750
RELA	Activation	16423052;20658750

Show/Hide all (70)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0000165	Process	MAPK cascade	IEA
GO:0002224	Process	Toll-like receptor signaling pathway	IBA
GO:0002376	Process	Immune system process	IEA
GO:0003725	Function	Double-stranded RNA binding	IDA	16111635
GO:0003727	Function	Single-stranded RNA binding	IEA
GO:0003727	Function	Single-stranded RNA binding	IMP	35477763
GO:0003727	Function	Single-stranded RNA binding	ISS
GO:0005515	Function	Protein binding	IPI	33432245
GO:0005737	Component	Cytoplasm	IDA	19740627
GO:0005764	Component	Lysosome	IEA
GO:0005764	Component	Lysosome	ISS
GO:0005768	Component	Endosome	IEA
GO:0005768	Component	Endosome	ISS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	19740627
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007249	Process	Canonical NF-kappaB signal transduction	IBA
GO:0007249	Process	Canonical NF-kappaB signal transduction	IMP	35477763
GO:0007254	Process	JNK cascade	IEA
GO:0010008	Component	Endosome membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032009	Component	Early phagosome	IEA
GO:0032009	Component	Early phagosome	ISS
GO:0032722	Process	Positive regulation of chemokine production	IDA	19740627
GO:0032727	Process	Positive regulation of interferon-alpha production	IDA	16286015
GO:0032727	Process	Positive regulation of interferon-alpha production	IEA
GO:0032728	Process	Positive regulation of interferon-beta production	IDA	16286015
GO:0032728	Process	Positive regulation of interferon-beta production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IDA	16286015
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IBA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	19740627
GO:0032757	Process	Positive regulation of interleukin-8 production	IEA
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	16188996
GO:0034154	Process	Toll-like receptor 7 signaling pathway	IBA
GO:0034154	Process	Toll-like receptor 7 signaling pathway	IDA	12032557
GO:0034154	Process	Toll-like receptor 7 signaling pathway	IEA
GO:0034158	Process	Toll-like receptor 8 signaling pathway	IEA
GO:0035197	Function	SiRNA binding	IEA
GO:0035197	Function	SiRNA binding	ISS
GO:0036020	Component	Endolysosome membrane	IEA
GO:0036020	Component	Endolysosome membrane	TAS
GO:0038187	Function	Pattern recognition receptor activity	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	12032557, 19740627
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	IMP	35477763
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IDA	19740627
GO:0051607	Process	Defense response to virus	IBA
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	IEP	32634389
GO:0051607	Process	Defense response to virus	IMP	16188996
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0070305	Process	Response to cGMP	IMP	35477763
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0098542	Process	Defense response to other organism	IEA
GO:0098586	Process	Cellular response to virus	IEA
GO:0140894	Process	Endolysosomal toll-like receptor signaling pathway	IEA

MIM	HGNC	e!Ensembl
300365	15631	ENSG00000196664

Q9NYK1

Protein name

Toll-like receptor 7

Protein function

Endosomal receptor that plays a key role in innate and adaptive immunity (PubMed:14976261, PubMed:32433612). Controls host immune response against pathogens through recognition of uridine-containing single strand RNAs (ssRNAs) of viral origin or

PDB

7CYN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13855	LRR_8	496 → 554	Leucine rich repeat	Repeat
PF00560	LRR_1	700 → 743	Leucine Rich Repeat	Repeat
PF01582	TIR	890 → 1048	TIR domain	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in brain, placenta, spleen, stomach, small intestine, lung and in plasmacytoid pre-dendritic cells. Expressed in peripheral mononuclear blood cells (PubMed:32706371). {ECO:0000269|PubMed:32706371}.

Sequence

MVFPMWTLKRQILILFNIILISKLLGARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIP
GGIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKP
RSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKENLTELANIEILYLG
QNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTAVPTVLPSTLTELYLYNNMIAKI
QEDDFNNLNQLQILDLSGNCPRCYNAPFPCAPCKNNSPLQIPVNAFDALTELKVLRLHSN
SLQHVPPRWFKNINKLQELDLSQNFLAKEIGDAKFLHFLPSLIQLDLSFNFELQVYRASM
NLSQAFSSLKSLKILRIRGYVFKELKSFNLSPLHNLQNLEVLDLGTNFIKIANLSMFKQF
KRLKVIDLSVNKISPSGDSSEVGFCSNARTSVESYEPQVLEQLHYFRYDKYARSCRFKNK
EASFMSVNESCYKYGQTLDLSKNSIFFVKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQP
LAELRYLDFSNNRLDLLHSTAFEELHKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQK
LMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWREGDNRYLQLFKNLLKLEELDISKN
SLSFLPSGVFDGMPPNLKNLSLAKNGLKSFSWKKLQCLKNLETLDLSHNQLTTVPERLSN
CSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPENVLNNLKMLLL
HHNRFLCTCDAVWFVWWVNHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTCELDLTNL
ILFSLSISVSLFLMVMMTASHLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTK
DPAVTEWVLAELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDK
YAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQ
AHPYFWQCLKNALATDNHVAYSQVFKETV

Sequence length

1049

Interactions

View interactions

	KEGG		Reactome
	Neutrophil extracellular trap formation Toll-like receptor signaling pathway Measles Influenza A Coronavirus disease - COVID-19		Trafficking and processing of endosomal TLR Toll Like Receptor 7/8 (TLR7/8) Cascade TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation MyD88 dependent cascade initiated on endosome

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Immunodeficiency 74, COVID-19-related, X-linked	Pathogenic	rs2042915990, rs200553089	RCV001254821 RCV001254822
Systemic lupus erythematosus	Pathogenic	rs2147245859	RCV002259554
Systemic lupus erythematosus 17	Pathogenic	rs2147245859, rs2147245261	RCV002251771 RCV002248405

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs5743780	RCV005926344
Cervical cancer	Benign	rs5743780	RCV005926345
Clear cell carcinoma of kidney	Benign	rs5743780	RCV005926346
Gastric cancer	Benign	rs5743780	RCV005926348
Lung cancer	Benign	rs5743780	RCV005926352
Melanoma	Benign	rs5743780	RCV005926351
Nonpapillary renal cell carcinoma	Likely benign	rs2518439419	RCV005927013
Ovarian serous cystadenocarcinoma	Benign	rs5743780	RCV005926349
Sarcoma	Benign	rs5743780	RCV005926347
Thyroid cancer, nonmedullary, 1	Benign; Uncertain significance; Likely benign	rs5743780, rs202231595, rs200048239	RCV005926350 RCV005926760 RCV005926831
TLR7-related disorder	Conflicting classifications of pathogenicity; Benign; Likely benign	rs201304033, rs5743781, rs55907843	RCV003900914 RCV003928462 RCV003968014

Show/Hide Text Mining Associations (201)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acute Kidney Injury	Associate	31531603
Adenocarcinoma of Lung	Associate	37746997
Agnosia	Associate	28856441
Aicardi Syndrome	Associate	26888781
Anemia Hemolytic Autoimmune	Associate	34981838
Antiphospholipid Syndrome	Associate	30864219
Aortic Valve Stenosis	Associate	32708790
Appendicitis	Associate	24336024
Arthritis	Associate	35508687
Arthritis Juvenile	Associate	28935693
Arthritis Psoriatic	Associate	33936047
Arthritis Rheumatoid	Associate	16052591, 18765427, 21179534, 22730373, 24740301, 30091955, 31376255, 33377396
Arthritis Rheumatoid	Stimulate	31501466
Asthma	Associate	19643938, 23861935, 24375473, 26725554, 28592890, 33236850
Asthma	Inhibit	26815632, 32513781
Ataxia Telangiectasia	Associate	34686943
Atherosclerosis	Associate	27864310
Autism Spectrum Disorder	Associate	22226452
Autoimmune Diseases	Associate	23386618, 24375473, 24740301, 30230983, 31069824, 31501466, 32219875, 37723501, 38077311
Biliary Atresia	Associate	17075576
Brachydactyly Type D	Associate	28504607
Breast Neoplasms	Associate	31789409, 33679700
Bronchiolitis	Associate	26741133, 28592890
Cancer Pain	Associate	30610800
Carcinoma Adenoid Cystic	Associate	26888781
Carcinoma Basal Cell	Associate	17313672
Carcinoma Hepatocellular	Stimulate	27588480
Carcinoma Hepatocellular	Associate	28963470
Carcinoma Pancreatic Ductal	Associate	31314777, 31381571
Carcinoma Squamous Cell	Associate	18794336
Carcinoma Squamous Cell	Stimulate	21527067
Carcinoma Squamous Cell	Inhibit	34987310
Cardio Renal Syndrome	Inhibit	27864310
Cardiovascular Diseases	Inhibit	27864310
Celiac Disease	Associate	28028951
Chemical and Drug Induced Liver Injury	Associate	34482844
Choledochal Cyst	Associate	17075576
Chronic Pain	Associate	29271858
Cold Injury	Associate	32513781
Colitis Ulcerative	Associate	22185629, 27895398
Colonic Neoplasms	Associate	37049910
Colorectal Neoplasms	Associate	28569041
Common Variable Immunodeficiency	Associate	19592080, 22048980, 27188997, 37626865
Communicable Diseases	Associate	24375473
Coronavirus Infections	Associate	32361001
COVID 19	Inhibit	27164085
COVID 19	Associate	32706371, 33138195, 33428154, 33650967, 33752797, 34064104, 34193364, 34330889, 34367187, 34413140, 34686943, 34858409, 34952932, 35063671, 35178710 View all (10 more)
COVID 19	Stimulate	33936047, 34656288, 36526691
Critical Illness	Associate	20957032, 37567916
Crohn Disease	Associate	19094116
Cryoglobulinemia Familial Mixed	Associate	34724826
Cytokine Release Syndrome	Stimulate	18535206
Cytokine Release Syndrome	Associate	19449004, 30944547
Dermatitis Atopic 1	Stimulate	19639721
Dermatitis Contact	Associate	28935206
Dermatomyositis	Associate	20309865, 31135059
Diabetes Mellitus	Associate	25586463, 31531603
Diabetes Mellitus Type 2	Stimulate	25586463
Diabetes Mellitus Type 2	Associate	36552771
Disease	Associate	33446885
Drug Hypersensitivity	Associate	24375473
Encephalitis Tick Borne	Associate	26783340
Epilepsy	Associate	31511910
Epilepsy Tonic Clonic	Inhibit	27864310
Esophageal Neoplasms	Associate	29968427
Esophageal Squamous Cell Carcinoma	Stimulate	21990957
Esophageal Squamous Cell Carcinoma	Associate	29968427
Fever	Associate	34482844
Fibrosis	Associate	23425350, 34112765
Gastroesophageal Reflux	Associate	29968427
Glioma	Associate	34134771, 34404444
Glomerulonephritis IGA	Associate	27818460, 31489594
Graves Disease	Associate	24517461, 28013570
Graves Disease	Inhibit	28013570
Graves Ophthalmopathy	Associate	24517461
Hashimoto Disease	Associate	39508448
Heart Block	Associate	26432597
Helicobacter Infections	Associate	36317079
Hepatitis B	Associate	28321161, 28963470
Hepatitis B Chronic	Associate	28321161, 28963470
Hepatitis C	Associate	25126563, 26023919, 30232187
Hepatitis C Chronic	Associate	23425350, 27135246
Hereditary Autoinflammatory Diseases	Associate	34981838
Herpes Simplex	Stimulate	16423052
HIV Infections	Associate	19596987, 20693428, 23131038, 24096630, 25928881, 27168019, 28179531, 30147152, 32554924, 32565728, 33193416, 33350746, 36271499
HTLV I Infections	Associate	39650644
Hypopigmentation	Associate	34614305
Hypoxia	Stimulate	31531603
Idiopathic Pulmonary Fibrosis	Associate	34112765
IgA Vasculitis	Associate	27818460
Ige Responsiveness Atopic	Associate	19639721
Immune System Diseases	Associate	27895398, 34482844, 34686943, 34981838
Immune System Diseases	Stimulate	40062898
Immunologic Deficiency Syndromes	Associate	34367187
Infections	Associate	21957307, 39650644
Infections	Stimulate	22617845
Infections	Inhibit	23028330
Inflammation	Associate	18765427, 19843090, 20309865, 21952587, 23386618, 31531603, 32219875, 34981838, 37433968, 39650644
Inflammation	Stimulate	21307198, 23861935, 25586463, 27729782, 37256770
Inflammation	Inhibit	32708790
Inflammatory Bowel Diseases	Associate	36847442
Influenza Human	Stimulate	20410486, 23552014
Intracranial Aneurysm	Associate	40389926
Jaundice	Associate	34482844
Klinefelter Syndrome	Stimulate	31069824
Klinefelter Syndrome	Associate	37723501
Laminopathies	Stimulate	29895224
Langerhans Cell Sarcoma	Associate	23221735
Laryngeal Neoplasms	Associate	21478107
Leukemia	Associate	19449004, 20859626
Leukemia Lymphocytic Chronic B Cell	Associate	16517754, 17768129, 21750087, 22437326, 24719462, 25416804
Leukemia Myeloid	Associate	24307172
Leukemia Myeloid Acute	Associate	19449004
Leukopenia	Associate	40516124
Lichenoid Eruptions	Associate	28715461
Liver Cirrhosis	Associate	27135246, 28963470
Liver Failure Acute	Associate	27284092
Liver Neoplasms	Stimulate	26301107
Lung Injury	Associate	39265238
Lung Neoplasms	Associate	20237413, 34596365
Lupus Erythematosus Systemic	Associate	16887967, 18373699, 20733074, 21396113, 22513098, 22952664, 23468661, 24375473, 24445780, 24692849, 25210799, 25485543, 27699260, 28506291, 29321042 View all (21 more)
Lupus Erythematosus Systemic	Stimulate	23497717, 24445780
Lupus Nephritis	Associate	27635115, 35392757
Lymphoma	Associate	16517754
Lymphoma B Cell	Associate	16517754
Lymphoma B Cell Marginal Zone	Associate	26294727
Microcephaly	Associate	36859461
Mitochondrial Diseases	Stimulate	31135059
Mixed Connective Tissue Disease	Associate	33336388
Mouth Diseases	Associate	30121951
Mouth Diseases	Stimulate	31511910
Mucocutaneous Lymph Node Syndrome	Associate	28707750, 34193364
Multiple Myeloma	Associate	23593278, 35365613
Multiple Sclerosis	Associate	23636665, 26996115, 27036414
Multiple Sclerosis Relapsing Remitting	Associate	27036414
Muscle Neoplasms	Associate	20309865
Muscle Weakness	Associate	31135059
Muscular Dystrophy Duchenne	Associate	34922439
Myelodysplastic Syndromes	Associate	24690917, 34130612
Myocardial Ischemia	Associate	31531603
Myositis	Associate	20309865, 31135059
Myotonic Dystrophy	Associate	39529136
Nasopharyngeal Carcinoma	Associate	31238894
Neoplasm Metastasis	Associate	27522582, 28856441
Neoplasms	Inhibit	18245549
Neoplasms	Associate	18794336, 20237413, 21478107, 21527067, 21990957, 24375473, 25825448, 28856441, 29968427, 31238894, 31314777, 31381571, 34404444, 35937402, 36613950, 37049910 View all (1 more)
Nephrogenic Fibrosing Dermopathy	Associate	22649203
Neuroinflammatory Diseases	Stimulate	31511910
NOG Related Symphalangism Spectrum Disorder	Associate	26228277
Obesity	Associate	21461352, 36552771
Osteoarthritis	Associate	21337319, 23255072, 32788627, 35508687
Osteoarthritis	Stimulate	35734177
Osteoarthritis Knee	Associate	35508687, 35785145
Otitis	Associate	24785236
Ovarian Neoplasms	Associate	30610800, 35464051
Pancreatic Neoplasms	Associate	35536778
Papillomavirus Infections	Associate	21527067, 29271858, 33013878
Papillomavirus Infections	Stimulate	29930251
Pemphigus	Associate	36349750
Pericardial Effusion	Associate	24445780
Periodic fever familial autosomal dominant	Stimulate	33983685
Plaque Atherosclerotic	Associate	27864310
Polymyositis	Associate	20309865, 31135059
Polysaccharide Storage of Unusual	Associate	22226452
Prostatitis	Associate	36613950
Proteinuria	Associate	31489594
Psoriasis	Associate	28935206
Pulmonary Atelectasis	Associate	34089082
Pulmonary Disease Chronic Obstructive	Associate	32757672
Purpura Thrombocytopenic Idiopathic	Associate	40674768
Respiratory Distress Syndrome	Associate	39265238
Respiratory Syncytial Virus Infections	Associate	19386802
Rhinitis Allergic	Associate	22857391, 28228119
RNA Virus Infections	Associate	31662487
Severe Acute Respiratory Syndrome	Associate	32706371
Signs and Symptoms Digestive	Associate	34482844
Sjogren's Syndrome	Associate	25113744, 26332048, 27943374, 29655283, 30446998, 30846988
Skin Neoplasms	Associate	19516264
Soft Tissue Injuries	Associate	26432597
Squamous Cell Carcinoma of Head and Neck	Stimulate	17201162
Squamous Cell Carcinoma of Head and Neck	Associate	25941114, 28856441, 30794027
Status Asthmaticus	Associate	33236850
Still's Disease Adult Onset	Stimulate	23497717
Still's Disease Adult Onset	Associate	35715478
Stomach Neoplasms	Stimulate	33982398
Substance Related Disorders	Associate	34482844
Synovitis	Associate	33377396, 35508687
Tuberous Sclerosis	Associate	31511910
Turner Syndrome	Stimulate	31069824
Turner Syndrome	Associate	36758851
Urethral Neoplasms	Associate	26228277
Urinary Bladder Neoplasms	Inhibit	25550860
Urinary Bladder Neoplasms	Associate	25550860
Uterine Cervical Dysplasia	Stimulate	21527067
Uterine Cervical Neoplasms	Associate	23221735
Uterine Cervical Neoplasms	Stimulate	25309919
Uterine Cervicitis	Associate	21527067
Vaginosis Bacterial	Associate	25928881
Viremia	Associate	32554924
Virus Diseases	Associate	23824215, 24886842, 30453684, 35063671
Zika Virus Infection	Associate	36859461

TLR7 (toll like receptor 7)