Gene Gene information from NCBI Gene database.
Entrez ID 51272
Gene name Bet1 golgi vesicular membrane trafficking protein like
Gene symbol BET1L
Synonyms (NCBI Gene)
BET1L1GOLIM3GS15HSPC197
Chromosome 11
Chromosome location 11p15.5
miRNA miRNA information provided by mirtarbase database.
401
miRTarBase ID miRNA Experiments Reference
MIRT044735 hsa-miR-320a CLASH 23622248
MIRT036358 hsa-miR-1229-3p CLASH 23622248
MIRT663805 hsa-miR-216a-5p HITS-CLIP 23824327
MIRT663804 hsa-miR-5197-5p HITS-CLIP 23824327
MIRT663803 hsa-miR-183-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0000139 Component Golgi membrane TAS
GO:0005484 Function SNAP receptor activity IBA
GO:0005484 Function SNAP receptor activity IDA 15215310
GO:0005484 Function SNAP receptor activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
615417 19348 ENSG00000177951
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NYM9
Protein name BET1-like protein (Golgi SNARE with a size of 15 kDa) (GOS-15) (GS15) (Vesicle transport protein GOS15)
Protein function Vesicle SNARE required for targeting and fusion of retrograde transport vesicles with the Golgi complex. Required for the integrity of the Golgi complex (By similarity).
Family and domains
Sequence
MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMDSDF
TSMTSLLTGSVKRFSTMARSGQDNRKLLCGMAVGLIVAFFILSYFLSRART
Sequence length 111
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  SNARE interactions in vesicular transport   COPI-mediated anterograde transport
Intra-Golgi traffic