Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51272
Gene name Gene Name - the full gene name approved by the HGNC.
Bet1 golgi vesicular membrane trafficking protein like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BET1L
Synonyms (NCBI Gene) Gene synonyms aliases
BET1L1, GOLIM3, GS15, HSPC197
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p15.5
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT044735 hsa-miR-320a CLASH 23622248
MIRT036358 hsa-miR-1229-3p CLASH 23622248
MIRT663805 hsa-miR-216a-5p HITS-CLIP 23824327
MIRT663804 hsa-miR-5197-5p HITS-CLIP 23824327
MIRT663803 hsa-miR-183-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0000139 Component Golgi membrane TAS
GO:0005484 Function SNAP receptor activity IBA
GO:0005484 Function SNAP receptor activity IDA 15215310
GO:0005484 Function SNAP receptor activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
615417 19348 ENSG00000177951
Protein
UniProt ID Q9NYM9
Protein name BET1-like protein (Golgi SNARE with a size of 15 kDa) (GOS-15) (GS15) (Vesicle transport protein GOS15)
Protein function Vesicle SNARE required for targeting and fusion of retrograde transport vesicles with the Golgi complex. Required for the integrity of the Golgi complex (By similarity).
Family and domains
Sequence
MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMDSDF
TSMTSLLTGSVKRFSTMARSGQDNRKLLCGMAVGLIVAFFILSYFLSRART
Sequence length 111
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  SNARE interactions in vesicular transport   COPI-mediated anterograde transport
Intra-Golgi traffic
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Intracranial Aneurysm Intracranial aneurysm N/A N/A GWAS
Uterine Fibroids Uterine fibroids N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Congenital Disorders of Glycosylation Associate 16510524
Intracranial Aneurysm Associate 31275455
Leiomyoma Associate 23604678, 23892540, 29743541, 35477381