Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	51267
Gene name	C-type lectin domain family 1 member A
Gene symbol	CLEC1A
Synonyms (NCBI Gene)	CLEC-1CLEC1
Chromosome	12
Chromosome location	12p13.2
Summary	This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles i

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs2306894	C>A,G	Risk-factor	Coding sequence variant, 5 prime UTR variant, missense variant

Show/Hide all (54)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023827	hsa-miR-1-3p	Microarray	18668037
MIRT895789	hsa-miR-1265	CLIP-seq
MIRT895790	hsa-miR-134	CLIP-seq
MIRT895791	hsa-miR-186	CLIP-seq
MIRT895792	hsa-miR-3118	CLIP-seq
MIRT895793	hsa-miR-3136-5p	CLIP-seq
MIRT895794	hsa-miR-3192	CLIP-seq
MIRT895795	hsa-miR-3919	CLIP-seq
MIRT895796	hsa-miR-4314	CLIP-seq
MIRT895797	hsa-miR-4439	CLIP-seq
MIRT895798	hsa-miR-4646-5p	CLIP-seq
MIRT895799	hsa-miR-4747-5p	CLIP-seq
MIRT895800	hsa-miR-4756-3p	CLIP-seq
MIRT895801	hsa-miR-4762-3p	CLIP-seq
MIRT895802	hsa-miR-502-5p	CLIP-seq
MIRT895803	hsa-miR-581	CLIP-seq
MIRT895804	hsa-miR-943	CLIP-seq
MIRT895790	hsa-miR-134	CLIP-seq
MIRT895792	hsa-miR-3118	CLIP-seq
MIRT895794	hsa-miR-3192	CLIP-seq
MIRT895796	hsa-miR-4314	CLIP-seq
MIRT895798	hsa-miR-4646-5p	CLIP-seq
MIRT895799	hsa-miR-4747-5p	CLIP-seq
MIRT895790	hsa-miR-134	CLIP-seq
MIRT895792	hsa-miR-3118	CLIP-seq
MIRT895794	hsa-miR-3192	CLIP-seq
MIRT895796	hsa-miR-4314	CLIP-seq
MIRT895798	hsa-miR-4646-5p	CLIP-seq
MIRT895799	hsa-miR-4747-5p	CLIP-seq
MIRT1965626	hsa-miR-1200	CLIP-seq
MIRT895790	hsa-miR-134	CLIP-seq
MIRT1965627	hsa-miR-3074-5p	CLIP-seq
MIRT895792	hsa-miR-3118	CLIP-seq
MIRT1965628	hsa-miR-3124-3p	CLIP-seq
MIRT895794	hsa-miR-3192	CLIP-seq
MIRT895795	hsa-miR-3919	CLIP-seq
MIRT895796	hsa-miR-4314	CLIP-seq
MIRT895798	hsa-miR-4646-5p	CLIP-seq
MIRT895799	hsa-miR-4747-5p	CLIP-seq
MIRT895800	hsa-miR-4756-3p	CLIP-seq
MIRT895790	hsa-miR-134	CLIP-seq
MIRT1965627	hsa-miR-3074-5p	CLIP-seq
MIRT895792	hsa-miR-3118	CLIP-seq
MIRT1965628	hsa-miR-3124-3p	CLIP-seq
MIRT895794	hsa-miR-3192	CLIP-seq
MIRT895796	hsa-miR-4314	CLIP-seq
MIRT895798	hsa-miR-4646-5p	CLIP-seq
MIRT895799	hsa-miR-4747-5p	CLIP-seq
MIRT895790	hsa-miR-134	CLIP-seq
MIRT895792	hsa-miR-3118	CLIP-seq
MIRT895794	hsa-miR-3192	CLIP-seq
MIRT895796	hsa-miR-4314	CLIP-seq
MIRT895798	hsa-miR-4646-5p	CLIP-seq
MIRT895799	hsa-miR-4747-5p	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IBA
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	10671229
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS	10671229
GO:0007165	Process	Signal transduction	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	10671229
GO:0016020	Component	Membrane	IEA
GO:0030246	Function	Carbohydrate binding	IEA

MIM	HGNC	e!Ensembl
606782	24355	ENSG00000150048

Q8NC01

Protein name

C-type lectin domain family 1 member A (C-type lectin-like receptor 1) (CLEC-1)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00059	Lectin_C	154 → 259	Lectin C-type domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed preferentially in dendritic cells. {ECO:0000269|PubMed:10671229}.

Sequence

MQAKYSSTRDMLDDDGDTTMSLHSQGSATTRHPEPRRTEHRAPSSTWRPVALTLLTLCLV
LLIGLAALGLLFFQYYQLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEK
LCRELYNKAGAHRCSPCTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQED
LEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAIL
NGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD

Sequence length

280

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Aspergillosis, susceptibility to	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Acute Kidney Injury	Associate	36385130	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	36327221	★★★★★ ★☆☆☆☆ Found in Text Mining only

CLEC1A (C-type lectin domain family 1 member A)