CLEC1B (C-type lectin domain family 1 member B)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51266
Gene name Gene Name - the full gene name approved by the HGNC.
C-type lectin domain family 1 member B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CLEC1B
Synonyms (NCBI Gene) Gene synonyms aliases
1810061I13Rik, CLEC2, CLEC2B, PRO1384, QDED721
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.31-p13.2
Summary Summary of gene provided in NCBI Entrez Gene.
Natural killer (NK) cells express multiple calcium-dependent (C-type) lectin-like receptors, such as CD94 (KLRD1; MIM 602894) and NKG2D (KLRC4; MIM 602893), that interact with major histocompatibility complex class I molecules and either inhibit or activa
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(3)
miRTarBase ID miRNA Experiments Reference
MIRT895805 hsa-miR-129-3p CLIP-seq
MIRT895806 hsa-miR-338-5p CLIP-seq
MIRT895807 hsa-miR-938 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(10)
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity IDA 18955485
GO:0005515 Function Protein binding IPI 17616532, 18215137, 19785988
GO:0005886 Component Plasma membrane TAS
GO:0005887 Component Integral component of plasma membrane TAS 10671229
GO:0006952 Process Defense response TAS 10671229
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
606783 24356 ENSG00000165682
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID Q9P126
Protein name C-type lectin domain family 1 member B (C-type lectin-like receptor 2) (CLEC-2)
Protein function C-type lectin-like receptor that functions as a platelet receptor for the lymphatic endothelial marker, PDPN (PubMed:18215137). After ligand activation, signals via sequential activation of SRC and SYK tyrosine kinases leading to activation of P
PDB 2C6U , 3WSR , 3WWK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 119 → 218 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed preferentially in the liver. Also expressed in immune cells of myeloid origin and on the surface of platelets. {ECO:0000269|PubMed:10671229, ECO:0000269|PubMed:16174766, ECO:0000269|PubMed:16940507}.
Sequence 
MQDEDGYITLNIKTRKPALISVGSASSSWWRVMALILLILCVGMVVGLVALGIWSVMQRN
YLQGENENRTGTLQQLAKRFCQYVVKQSELKGTFKGHKCSPCDTNWRYYGDSCYGFFRHN
LTWEESKQYCTDMNATLLKIDNRNIVEYIKARTHLIRWVGLSRQKSNEVWKWEDGSVISE
NMFEFLEDGKGNMNCAYFHNGKMHPTFCENKHYLMCERKAGMTKVDQLP
Sequence length 229
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  KEGG   Reactome
  C-type lectin receptor signaling pathway   GPVI-mediated activation cascade