CLEC1B (C-type lectin domain family 1 member B)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID 51266
Gene name C-type lectin domain family 1 member B
Gene symbol CLEC1B
Synonyms (NCBI Gene)
1810061I13RikCLEC2CLEC2BPRO1384QDED721
Chromosome 12
Chromosome location 12p13.31-p13.2
Summary Natural killer (NK) cells express multiple calcium-dependent (C-type) lectin-like receptors, such as CD94 (KLRD1; MIM 602894) and NKG2D (KLRC4; MIM 602893), that interact with major histocompatibility complex class I molecules and either inhibit or activa
miRNA miRNA information provided by mirtarbase database.
3
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (3)
miRTarBase ID miRNA Experiments Reference
MIRT895805 hsa-miR-129-3p CLIP-seq
MIRT895806 hsa-miR-338-5p CLIP-seq
MIRT895807 hsa-miR-938 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (17)
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity IBA
GO:0004888 Function Transmembrane signaling receptor activity IDA 18955485
GO:0004888 Function Transmembrane signaling receptor activity TAS 10671229
GO:0005515 Function Protein binding IPI 17616532, 18215137, 19785988, 25458834
GO:0005886 Component Plasma membrane IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
606783 24356 ENSG00000165682
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9P126
Protein name C-type lectin domain family 1 member B (C-type lectin-like receptor 2) (CLEC-2)
Protein function C-type lectin-like receptor that functions as a platelet receptor for the lymphatic endothelial marker, PDPN (PubMed:18215137). After ligand activation, signals via sequential activation of SRC and SYK tyrosine kinases leading to activation of P
PDB 2C6U , 3WSR , 3WWK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 119 → 218 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed preferentially in the liver. Also expressed in immune cells of myeloid origin and on the surface of platelets. {ECO:0000269|PubMed:10671229, ECO:0000269|PubMed:16174766, ECO:0000269|PubMed:16940507}.
Sequence 
MQDEDGYITLNIKTRKPALISVGSASSSWWRVMALILLILCVGMVVGLVALGIWSVMQRN
YLQGENENRTGTLQQLAKRFCQYVVKQSELKGTFKGHKCSPCDTNWRYYGDSCYGFFRHN
LTWEESKQYCTDMNATLLKIDNRNIVEYIKARTHLIRWVGLSRQKSNEVWKWEDGSVISE
NMFEFLEDGKGNMNCAYFHNGKMHPTFCENKHYLMCERKAGMTKVDQLP
Sequence length 229
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  KEGG  Reactome
  C-type lectin receptor signaling pathway   GPVI-mediated activation cascade