Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	51251
Gene name Gene Name - the full gene name approved by the HGNC.	5'-nucleotidase, cytosolic IIIA
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NT5C3A
Synonyms (NCBI Gene) Gene synonyms aliases	CNSHA8, NT5C3, P5'N-1, P5N-1, PN-I, POMP, PSN1, UMPH, UMPH1, cN-III, hUMP1, p36
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7p14.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the 5`-nucleotidase family of enzymes that catalyze the dephosphorylation of nucleoside 5`-monophosphates. The encoded protein is the type 1 isozyme of pyrimidine 5` nucleotidase and catalyzes the dephosphorylation of pyrimid

Show/Hide all(10)

SNP ID	Visualize variation	Clinical significance	Consequence
rs104894025	T>A	Pathogenic	Missense variant, coding sequence variant
rs104894026	G>A	Pathogenic	Coding sequence variant, stop gained
rs104894027	A>C	Pathogenic	Coding sequence variant, stop gained
rs104894028	T>C	Pathogenic	Missense variant, coding sequence variant
rs104894029	C>G	Pathogenic	Missense variant, intron variant, coding sequence variant
rs397518435	C>A,G	Pathogenic	Splice acceptor variant, intron variant
rs397518436	->CC	Pathogenic	Frameshift variant, coding sequence variant, intron variant
rs397518437	->T	Pathogenic	Frameshift variant, coding sequence variant
rs397518438	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs1583884979	T>C	Likely-pathogenic	Splice acceptor variant

Show/Hide all(24)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005184	hsa-miR-30a-5p	pSILAC	18668040
MIRT007081	hsa-miR-122-5p	Luciferase reporter assay	23055569
MIRT007081	hsa-miR-122-5p	Luciferase reporter assay	23055569
MIRT005184	hsa-miR-30a-5p	Proteomics;Other	18668040
MIRT031382	hsa-miR-16-5p	Proteomics	18668040
MIRT044479	hsa-miR-320a	CLASH	23622248
MIRT555439	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT555445	hsa-miR-144-3p	PAR-CLIP	21572407
MIRT555444	hsa-miR-499a-3p	PAR-CLIP	21572407
MIRT555443	hsa-miR-499b-3p	PAR-CLIP	21572407
MIRT555442	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT555441	hsa-miR-520d-5p	PAR-CLIP	21572407
MIRT555440	hsa-miR-524-5p	PAR-CLIP	21572407
MIRT555439	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT555438	hsa-miR-582-5p	PAR-CLIP	21572407
MIRT555439	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT555445	hsa-miR-144-3p	PAR-CLIP	21572407
MIRT555444	hsa-miR-499a-3p	PAR-CLIP	21572407
MIRT555443	hsa-miR-499b-3p	PAR-CLIP	21572407
MIRT555442	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT555441	hsa-miR-520d-5p	PAR-CLIP	21572407
MIRT555440	hsa-miR-524-5p	PAR-CLIP	21572407
MIRT555439	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT555438	hsa-miR-582-5p	PAR-CLIP	21572407

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000215	Function	TRNA 2'-phosphotransferase activity	NAS	9428647
GO:0000215	Function	TRNA 2'-phosphotransferase activity	TAS	10942414
GO:0000287	Function	Magnesium ion binding	NAS	11795870
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	8557639
GO:0005783	Component	Endoplasmic reticulum	IDA	8557639
GO:0005829	Component	Cytosol	TAS
GO:0006213	Process	Pyrimidine nucleoside metabolic process	NAS	10942414
GO:0008253	Function	5'-nucleotidase activity	IBA	21873635
GO:0008253	Function	5'-nucleotidase activity	IDA	10942414
GO:0008253	Function	5'-nucleotidase activity	NAS	12930399
GO:0009117	Process	Nucleotide metabolic process	IEA
GO:0016311	Process	Dephosphorylation	IEA
GO:0046135	Process	Pyrimidine nucleoside catabolic process	TAS
GO:0051607	Process	Defense response to virus	IDA	21478870

MIM	HGNC	e!Ensembl
606224	17820	ENSG00000122643

Protein

UniProt ID

Q9H0P0

Protein name

Cytosolic 5'-nucleotidase 3A (EC 3.1.3.5) (7-methylguanosine phosphate-specific 5'-nucleotidase) (7-methylguanosine nucleotidase) (EC 3.1.3.91) (Cytosolic 5'-nucleotidase 3) (Cytosolic 5'-nucleotidase III) (cN-III) (Pyrimidine 5'-nucleotidase 1) (P5'N-1)

Protein function

Nucleotidase which shows specific activity towards cytidine monophosphate (CMP) and 7-methylguanosine monophosphate (m(7)GMP) (PubMed:24603684). CMP seems to be the preferred substrate (PubMed:15968458). {ECO:0000269|PubMed:15968458, ECO:0000269

PDB

2CN1 , 2JGA , 2VKQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05822	UMPH-1	91 → 336		Family

Tissue specificity

TISSUE SPECIFICITY: Isoforms 1, 3 and 4 are expressed in reticulocytes. Isoform 4 is hardly detectable in bone marrow and fetal liver. {ECO:0000269|PubMed:11369620, ECO:0000269|PubMed:15238149}.

Sequence

MRAPSMDRAAVARVGAVASASVCALVAGVVLAQYIFTLKRKTGRKTKIIEMMPEFQKSSV
RIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDEC
RKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVM
LKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLK
GFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYL
NDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL

Sequence length

336

Interactions

View interactions

	KEGG		Reactome
	Pyrimidine metabolism Metabolic pathways Nucleotide metabolism		Pyrimidine catabolism

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Anemia	Anemia, Hemolytic, Anemia, Hemolytic, Congenital Nonspherocytic	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966 View all (89 more)	16672222
Hemolytic anemia	Uridine 5-Prime Monophosphate Hydrolase Deficiency, Hemolytic Anemia due to, Hemolytic anemia due to pyrimidine 5` nucleotidase deficiency	rs104894025, rs104894026, rs397518435, rs397518436, rs104894027, rs397518437, rs104894028, rs397518438, rs104894029, rs137853583, rs137853585, rs137853586, rs137853587, rs267606851, rs267606852 View all (18 more)	11369620, 15968458, 27604308, 15604219, 18499901, 16461318, 12930399, 25153905, 12714505, 15238149

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References
Associations from Text Mining
5 Nucleotidase syndrome	Associate	15604219
Anemia Hemolytic	Associate	36434495
Anemia Hemolytic Congenital Nonspherocytic	Associate	15604219
Brain Neoplasms	Associate	11461077
Carcinogenesis	Associate	10838189
Colorectal Neoplasms	Associate	10838189
Meningioma	Associate	11461077
Myotonic Dystrophy	Associate	32902349
N acetyltransferase deficiency	Associate	11369620
Neoplasms	Associate	11461077, 18757419
Uridine 5 Prime Monophosphate Hydrolase Deficiency Hemolytic Anemia due to	Inhibit	11369620
Uridine 5 Prime Monophosphate Hydrolase Deficiency Hemolytic Anemia due to	Associate	11369620, 12930399, 36434495

NT5C3A (5'-nucleotidase, cytosolic IIIA)