Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	51222
Gene name	Zinc finger protein 219
Gene symbol	ZNF219
Synonyms (NCBI Gene)	ZFP219
Chromosome	14
Chromosome location	14q11.2
Summary	This gene is a member of the Kruppel-like zinc finger gene family. The encoded protein functions as a transcriptional repressor of the high mobility group nucleosome binding domain 1 protein, which is associated with transcriptionally active chromatin. [p

108

Show/Hide all (108)

miRTarBase ID	miRNA	Experiments	Reference
MIRT038511	hsa-miR-296-3p	CLASH	23622248
MIRT1518463	hsa-miR-1913	CLIP-seq
MIRT1518464	hsa-miR-324-3p	CLIP-seq
MIRT1518465	hsa-miR-370	CLIP-seq
MIRT1518466	hsa-miR-4313	CLIP-seq
MIRT1518467	hsa-miR-4684-5p	CLIP-seq
MIRT1518468	hsa-miR-662	CLIP-seq
MIRT1518469	hsa-miR-942	CLIP-seq
MIRT1518470	hsa-miR-124	CLIP-seq
MIRT1518471	hsa-miR-1251	CLIP-seq
MIRT1518472	hsa-miR-134	CLIP-seq
MIRT1518473	hsa-miR-3118	CLIP-seq
MIRT1518474	hsa-miR-3164	CLIP-seq
MIRT1518475	hsa-miR-3714	CLIP-seq
MIRT1518476	hsa-miR-3910	CLIP-seq
MIRT1518477	hsa-miR-4252	CLIP-seq
MIRT1518478	hsa-miR-4263	CLIP-seq
MIRT1518479	hsa-miR-4287	CLIP-seq
MIRT1518480	hsa-miR-4297	CLIP-seq
MIRT1518481	hsa-miR-4521	CLIP-seq
MIRT1518467	hsa-miR-4684-5p	CLIP-seq
MIRT1518482	hsa-miR-4685-3p	CLIP-seq
MIRT1518483	hsa-miR-4707-3p	CLIP-seq
MIRT1518484	hsa-miR-4727-5p	CLIP-seq
MIRT1518485	hsa-miR-4769-3p	CLIP-seq
MIRT1518486	hsa-miR-506	CLIP-seq
MIRT1518469	hsa-miR-942	CLIP-seq
MIRT2156444	hsa-miR-1225-5p	CLIP-seq
MIRT2156445	hsa-miR-1293	CLIP-seq
MIRT2156446	hsa-miR-1587	CLIP-seq
MIRT2156447	hsa-miR-2110	CLIP-seq
MIRT2156448	hsa-miR-3144-5p	CLIP-seq
MIRT2156449	hsa-miR-3150a-3p	CLIP-seq
MIRT2156450	hsa-miR-3189-3p	CLIP-seq
MIRT2156451	hsa-miR-3191	CLIP-seq
MIRT2156452	hsa-miR-3194-5p	CLIP-seq
MIRT2156453	hsa-miR-4431	CLIP-seq
MIRT2156454	hsa-miR-4483	CLIP-seq
MIRT2156455	hsa-miR-4492	CLIP-seq
MIRT2156456	hsa-miR-4498	CLIP-seq
MIRT2156457	hsa-miR-4505	CLIP-seq
MIRT2156458	hsa-miR-4652-5p	CLIP-seq
MIRT2156459	hsa-miR-4656	CLIP-seq
MIRT2156460	hsa-miR-4674	CLIP-seq
MIRT2156461	hsa-miR-4675	CLIP-seq
MIRT1518484	hsa-miR-4727-5p	CLIP-seq
MIRT2156462	hsa-miR-4741	CLIP-seq
MIRT1518485	hsa-miR-4769-3p	CLIP-seq
MIRT2156463	hsa-miR-635	CLIP-seq
MIRT2156464	hsa-miR-762	CLIP-seq
MIRT1518469	hsa-miR-942	CLIP-seq
MIRT1518477	hsa-miR-4252	CLIP-seq
MIRT2376006	hsa-miR-4725-5p	CLIP-seq
MIRT1518484	hsa-miR-4727-5p	CLIP-seq
MIRT1518485	hsa-miR-4769-3p	CLIP-seq
MIRT2376007	hsa-miR-504	CLIP-seq
MIRT2464081	hsa-miR-126	CLIP-seq
MIRT2464082	hsa-miR-1291	CLIP-seq
MIRT2464083	hsa-miR-146b-3p	CLIP-seq
MIRT2464084	hsa-miR-1914	CLIP-seq
MIRT2156447	hsa-miR-2110	CLIP-seq
MIRT2464085	hsa-miR-2276	CLIP-seq
MIRT2156448	hsa-miR-3144-5p	CLIP-seq
MIRT2156449	hsa-miR-3150a-3p	CLIP-seq
MIRT2156451	hsa-miR-3191	CLIP-seq
MIRT2464086	hsa-miR-3918	CLIP-seq
MIRT2156453	hsa-miR-4431	CLIP-seq
MIRT2464087	hsa-miR-4463	CLIP-seq
MIRT2464088	hsa-miR-4522	CLIP-seq
MIRT2156458	hsa-miR-4652-5p	CLIP-seq
MIRT2464089	hsa-miR-4772-3p	CLIP-seq
MIRT2464090	hsa-miR-487b	CLIP-seq
MIRT2464091	hsa-miR-545	CLIP-seq
MIRT2464092	hsa-miR-548u	CLIP-seq
MIRT2464093	hsa-miR-550a	CLIP-seq
MIRT2464094	hsa-miR-634	CLIP-seq
MIRT2464087	hsa-miR-4463	CLIP-seq
MIRT2464091	hsa-miR-545	CLIP-seq
MIRT2464092	hsa-miR-548u	CLIP-seq
MIRT2464094	hsa-miR-634	CLIP-seq
MIRT2464082	hsa-miR-1291	CLIP-seq
MIRT2464083	hsa-miR-146b-3p	CLIP-seq
MIRT2464084	hsa-miR-1914	CLIP-seq
MIRT2156447	hsa-miR-2110	CLIP-seq
MIRT2464085	hsa-miR-2276	CLIP-seq
MIRT2156448	hsa-miR-3144-5p	CLIP-seq
MIRT2156449	hsa-miR-3150a-3p	CLIP-seq
MIRT2156451	hsa-miR-3191	CLIP-seq
MIRT2464086	hsa-miR-3918	CLIP-seq
MIRT2156453	hsa-miR-4431	CLIP-seq
MIRT2464088	hsa-miR-4522	CLIP-seq
MIRT2156458	hsa-miR-4652-5p	CLIP-seq
MIRT2464089	hsa-miR-4772-3p	CLIP-seq
MIRT2464093	hsa-miR-550a	CLIP-seq
MIRT2464082	hsa-miR-1291	CLIP-seq
MIRT2464083	hsa-miR-146b-3p	CLIP-seq
MIRT2464084	hsa-miR-1914	CLIP-seq
MIRT2156447	hsa-miR-2110	CLIP-seq
MIRT2464085	hsa-miR-2276	CLIP-seq
MIRT2156448	hsa-miR-3144-5p	CLIP-seq
MIRT2156449	hsa-miR-3150a-3p	CLIP-seq
MIRT2156451	hsa-miR-3191	CLIP-seq
MIRT2464086	hsa-miR-3918	CLIP-seq
MIRT2156453	hsa-miR-4431	CLIP-seq
MIRT2464088	hsa-miR-4522	CLIP-seq
MIRT2156458	hsa-miR-4652-5p	CLIP-seq
MIRT2464089	hsa-miR-4772-3p	CLIP-seq
MIRT2464093	hsa-miR-550a	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	14621294
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	14621294
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	14621294
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IDA	14621294
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	14621294, 19549071
GO:0004969	Function	Histamine receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	19549071, 25416956, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	10819330, 14621294
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IMP	19549071
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0032332	Process	Positive regulation of chondrocyte differentiation	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	14621294
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060174	Process	Limb bud formation	IEA

MIM	HGNC	e!Ensembl
605036	13011	ENSG00000165804

Q9P2Y4

Protein name

Zinc finger protein 219

Protein function

Transcriptional regulator (PubMed:14621294, PubMed:19549071). Recognizes and binds 2 copies of the core DNA sequence motif 5'-GGGGG-3' (PubMed:14621294). Binds to the HMGN1 promoter and may repress HMGN1 expression (PubMed:14621294). Regulates S

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	57 → 79	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	85 → 107	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	274 → 296	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	302 → 324	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	499 → 520	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	526 → 549	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:10819330}.

Sequence

MEGSRPRAPSGHLAPSPPAFDGELDLQRYSNGPAVSAGSLGMGAVSWSESRAGERRFPCP
VCGKRFRFNSILALHLRAHPGAQAFQCPHCGHRAAQRALLRSHLRTHQPERPRSPAARLL
LELEERALLREARLGRARSSGGMQATPATEGLARPQAPSSSAFRCPYCKGKFRTSAERER
HLHILHRPWKCGLCSFGSSQEEELLHHSLTAHGAPERPLAATSAAPPPQPQPQPPPQPEP
RSVPQPEPEPEPEREATPTPAPAAPEEPPAPPEFRCQVCGQSFTQSWFLKGHMRKHKASF
DHACPVCGRCFKEPWFLKNHMKVHASKLGPLRAPGPASGPARAPQPPDLGLLAYEPLGPA
LLLAPAPTPAERREPPSLLGYLSLRAGEGRPNGEGAEPGPGRSFGGFRPLSSALPARARR
HRAEEPEEEEEVVEAEEETWARGRSLGSLASLHPRPGEGPGHSASAAGAQARSTATQEEN
GLLVGGTRPEGGRGATGKDCPFCGKSFRSAHHLKVHLRVHTGERPYKCPHCDYAGTQSGS
LKYHLQRHHREQRSGAGPGPPPEPPPPSQRGSAPQSGAKPSPQPATWVEGASSPRPPSSG
AGPGSRRKPASPGRTLRNGRGGEAEPLDLSLRAGPGGEAGPGGALHRCLFCPFATGAPEL
MALHLQVHHSRRARGRRPPQADASPPYARVPSGETPPSPSQEGEEGSGLSRPGEAGLGGQ
ER

Sequence length

722

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MICROPHTHALMIA	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MICROPHTHALMOS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Hepatocellular	Associate	33541355	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	26222778	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF219 (zinc finger protein 219)