IGF2-AS (IGF2 antisense RNA)

Gene Gene information from NCBI Gene database.
Gene miRNA Other IDs Protein
Entrez ID 51214
Gene name IGF2 antisense RNA
Gene symbol IGF2-AS
Synonyms (NCBI Gene)
IGF2-AS1IGF2ASPEG8
Chromosome 11
Chromosome location 11p15.5
Summary This gene is expressed in antisense to the insulin-like growth factor 2 (IGF2) gene and is imprinted and paternally expressed. It is thought to be non-coding because the putative protein is not conserved and translation is predicted to trigger nonsense me
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Other IDs Protein
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT004204 hsa-miR-197-3p Microarray 16822819
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Other IDs Protein
MIM HGNC e!Ensembl
610146 14062 ENSG00000099869
Protein Protein information from UniProt database.
Gene miRNA Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6U949
Protein name Putative insulin-like growth factor 2 antisense gene protein (IGF2 antisense RNA 1) (IGF2 antisense gene protein 1) (PEG8/IGF2AS protein) (Putative insulin-like growth factor 2 antisense gene protein 1) (IGF2-AS1)
Family and domains
Sequence 
MSKRKWRGFRGAQQERAQPPAASPQPCPAPHAGLPGGSRRRAPAPAGQQQMRAESRSGAQ
RRRGSARRGAHREAGGCVRGRTRSSGSERSNALWQAVDAAEALALSSPLRRPWDQAQHFT
NPAPFSKGPQSAPPSPPAGRRRRGADLALTPLAGEGHTRWRQPGRPGK
Sequence length 168
Interactions View interactions