Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5121
Gene name Gene Name - the full gene name approved by the HGNC.	Purkinje cell protein 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PCP4
Synonyms (NCBI Gene) Gene synonyms aliases	PEP-19
Chromosome Chromosome number	21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	21q22.2

Show/Hide all(36)

miRTarBase ID	miRNA	Experiments
MIRT1218373	hsa-miR-1251	CLIP-seq
MIRT1218374	hsa-miR-1255a	CLIP-seq
MIRT1218375	hsa-miR-1255b	CLIP-seq
MIRT1218376	hsa-miR-147	CLIP-seq
MIRT1218377	hsa-miR-33a	CLIP-seq
MIRT1218378	hsa-miR-33b	CLIP-seq
MIRT1218379	hsa-miR-3667-3p	CLIP-seq
MIRT1218380	hsa-miR-3680	CLIP-seq
MIRT1218381	hsa-miR-3685	CLIP-seq
MIRT1218382	hsa-miR-3686	CLIP-seq
MIRT1218383	hsa-miR-3689d	CLIP-seq
MIRT1218384	hsa-miR-3691-5p	CLIP-seq
MIRT1218385	hsa-miR-376c	CLIP-seq
MIRT1218386	hsa-miR-3911	CLIP-seq
MIRT1218387	hsa-miR-3976	CLIP-seq
MIRT1218388	hsa-miR-4443	CLIP-seq
MIRT1218389	hsa-miR-4464	CLIP-seq
MIRT1218390	hsa-miR-4652-3p	CLIP-seq
MIRT1218391	hsa-miR-4748	CLIP-seq
MIRT1218392	hsa-miR-4752	CLIP-seq
MIRT1218393	hsa-miR-4768-5p	CLIP-seq
MIRT1218394	hsa-miR-4798-3p	CLIP-seq
MIRT1218395	hsa-miR-513a-5p	CLIP-seq
MIRT1218396	hsa-miR-586	CLIP-seq
MIRT1218397	hsa-miR-609	CLIP-seq
MIRT1218398	hsa-miR-617	CLIP-seq
MIRT1218399	hsa-miR-624	CLIP-seq
MIRT1218400	hsa-miR-644	CLIP-seq
MIRT1218401	hsa-miR-942	CLIP-seq
MIRT2063180	hsa-miR-1245b-3p	CLIP-seq
MIRT2063181	hsa-miR-4775	CLIP-seq
MIRT2063182	hsa-miR-526b	CLIP-seq
MIRT2063183	hsa-miR-578	CLIP-seq
MIRT1218377	hsa-miR-33a	CLIP-seq
MIRT1218378	hsa-miR-33b	CLIP-seq
MIRT1218396	hsa-miR-586	CLIP-seq

Show/Hide all(13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IDA	23204517
GO:0005515	Function	Protein binding	IPI	21044950, 32296183
GO:0005516	Function	Calmodulin binding	IBA
GO:0005516	Function	Calmodulin binding	IDA	23204517
GO:0005516	Function	Calmodulin binding	IEA
GO:0005516	Function	Calmodulin binding	IPI	19106096
GO:0005634	Component	Nucleus	HDA	16780588
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	HDA	16780588
GO:0032991	Component	Protein-containing complex	IDA	19106096
GO:0045666	Process	Positive regulation of neuron differentiation	IMP	21491429
GO:1905291	Process	Positive regulation of CAMKK-AMPK signaling cascade	IMP	21491429

MIM	HGNC	e!Ensembl
601629	8742	ENSG00000183036

Protein

UniProt ID

P48539

Protein name

Calmodulin regulator protein PCP4 (Brain-specific polypeptide PEP-19) (Purkinje cell protein 4)

Protein function

Functions as a modulator of calcium-binding by calmodulin. Thereby, regulates calmodulin activity and the different processes it controls (PubMed:19106096, PubMed:23204517, PubMed:27876793). For instance, may play a role in neuronal differentiat

PDB

2N77

Family and domains

Sequence

MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGS
QS

Sequence length

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Melanoma	Melanoma	N/A	N/A	GWAS

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adrenocortical Carcinoma	Associate	24403568
Breast Neoplasms	Associate	25153723, 27384474
Down Syndrome	Associate	10207158
Hyperaldosteronism	Associate	24403568
Leukemia	Associate	21044360
Neoplasms	Associate	27384474
Neuroblastoma	Associate	32641824
Osteoporosis	Associate	35030971
Prostatic Neoplasms	Associate	28700469

PCP4 (Purkinje cell protein 4)