Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	51206
Gene name Gene Name - the full gene name approved by the HGNC.	Glycoprotein VI platelet
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GP6
Synonyms (NCBI Gene) Gene synonyms aliases	BDPLT11, GPIV, GPVI
Disease Acronyms (UniProt) Disease acronyms from UniProt database	BDPLT11
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.42
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a platelet membrane glycoprotein of the immunoglobulin superfamily. The encoded protein is a receptor for collagen and plays a critical role in collagen-induced platelet aggregation and thrombus formation. The encoded protein forms a com

Show/Hide all(94)

miRTarBase ID	miRNA	Experiments
MIRT1028005	hsa-miR-1343	CLIP-seq
MIRT1028006	hsa-miR-1976	CLIP-seq
MIRT1028007	hsa-miR-25	CLIP-seq
MIRT1028008	hsa-miR-3120-3p	CLIP-seq
MIRT1028009	hsa-miR-3138	CLIP-seq
MIRT1028010	hsa-miR-32	CLIP-seq
MIRT1028011	hsa-miR-3545-3p	CLIP-seq
MIRT1028012	hsa-miR-363	CLIP-seq
MIRT1028013	hsa-miR-3663-5p	CLIP-seq
MIRT1028014	hsa-miR-367	CLIP-seq
MIRT1028015	hsa-miR-378g	CLIP-seq
MIRT1028016	hsa-miR-3942-5p	CLIP-seq
MIRT1028017	hsa-miR-4312	CLIP-seq
MIRT1028018	hsa-miR-4423-5p	CLIP-seq
MIRT1028019	hsa-miR-4437	CLIP-seq
MIRT1028020	hsa-miR-4520a-3p	CLIP-seq
MIRT1028021	hsa-miR-4635	CLIP-seq
MIRT1028022	hsa-miR-4666-5p	CLIP-seq
MIRT1028023	hsa-miR-4674	CLIP-seq
MIRT1028024	hsa-miR-4680-5p	CLIP-seq
MIRT1028025	hsa-miR-4703-5p	CLIP-seq
MIRT1028026	hsa-miR-4722-3p	CLIP-seq
MIRT1028027	hsa-miR-4757-5p	CLIP-seq
MIRT1028028	hsa-miR-4781-3p	CLIP-seq
MIRT1028029	hsa-miR-92a	CLIP-seq
MIRT1028030	hsa-miR-92b	CLIP-seq
MIRT2004956	hsa-miR-128	CLIP-seq
MIRT1028005	hsa-miR-1343	CLIP-seq
MIRT1028006	hsa-miR-1976	CLIP-seq
MIRT1028007	hsa-miR-25	CLIP-seq
MIRT1028008	hsa-miR-3120-3p	CLIP-seq
MIRT1028009	hsa-miR-3138	CLIP-seq
MIRT1028010	hsa-miR-32	CLIP-seq
MIRT1028011	hsa-miR-3545-3p	CLIP-seq
MIRT1028012	hsa-miR-363	CLIP-seq
MIRT1028014	hsa-miR-367	CLIP-seq
MIRT1028015	hsa-miR-378g	CLIP-seq
MIRT1028016	hsa-miR-3942-5p	CLIP-seq
MIRT1028019	hsa-miR-4437	CLIP-seq
MIRT1028020	hsa-miR-4520a-3p	CLIP-seq
MIRT1028022	hsa-miR-4666-5p	CLIP-seq
MIRT1028023	hsa-miR-4674	CLIP-seq
MIRT1028024	hsa-miR-4680-5p	CLIP-seq
MIRT1028025	hsa-miR-4703-5p	CLIP-seq
MIRT1028026	hsa-miR-4722-3p	CLIP-seq
MIRT1028029	hsa-miR-92a	CLIP-seq
MIRT1028030	hsa-miR-92b	CLIP-seq
MIRT2237639	hsa-miR-1273f	CLIP-seq
MIRT1028005	hsa-miR-1343	CLIP-seq
MIRT1028006	hsa-miR-1976	CLIP-seq
MIRT2237640	hsa-miR-219-2-3p	CLIP-seq
MIRT1028007	hsa-miR-25	CLIP-seq
MIRT2237641	hsa-miR-3115	CLIP-seq
MIRT1028008	hsa-miR-3120-3p	CLIP-seq
MIRT1028009	hsa-miR-3138	CLIP-seq
MIRT1028010	hsa-miR-32	CLIP-seq
MIRT2237642	hsa-miR-342-5p	CLIP-seq
MIRT1028011	hsa-miR-3545-3p	CLIP-seq
MIRT1028012	hsa-miR-363	CLIP-seq
MIRT1028013	hsa-miR-3663-5p	CLIP-seq
MIRT1028014	hsa-miR-367	CLIP-seq
MIRT2237643	hsa-miR-3675-5p	CLIP-seq
MIRT1028015	hsa-miR-378g	CLIP-seq
MIRT1028016	hsa-miR-3942-5p	CLIP-seq
MIRT1028017	hsa-miR-4312	CLIP-seq
MIRT1028018	hsa-miR-4423-5p	CLIP-seq
MIRT1028019	hsa-miR-4437	CLIP-seq
MIRT1028020	hsa-miR-4520a-3p	CLIP-seq
MIRT1028021	hsa-miR-4635	CLIP-seq
MIRT2237644	hsa-miR-4651	CLIP-seq
MIRT2237645	hsa-miR-4664-5p	CLIP-seq
MIRT1028022	hsa-miR-4666-5p	CLIP-seq
MIRT1028023	hsa-miR-4674	CLIP-seq
MIRT1028024	hsa-miR-4680-5p	CLIP-seq
MIRT1028025	hsa-miR-4703-5p	CLIP-seq
MIRT1028026	hsa-miR-4722-3p	CLIP-seq
MIRT1028027	hsa-miR-4757-5p	CLIP-seq
MIRT1028028	hsa-miR-4781-3p	CLIP-seq
MIRT2237646	hsa-miR-608	CLIP-seq
MIRT2237647	hsa-miR-615-5p	CLIP-seq
MIRT1028029	hsa-miR-92a	CLIP-seq
MIRT1028030	hsa-miR-92b	CLIP-seq
MIRT1028007	hsa-miR-25	CLIP-seq
MIRT1028008	hsa-miR-3120-3p	CLIP-seq
MIRT1028009	hsa-miR-3138	CLIP-seq
MIRT1028010	hsa-miR-32	CLIP-seq
MIRT1028012	hsa-miR-363	CLIP-seq
MIRT1028014	hsa-miR-367	CLIP-seq
MIRT1028016	hsa-miR-3942-5p	CLIP-seq
MIRT1028020	hsa-miR-4520a-3p	CLIP-seq
MIRT1028022	hsa-miR-4666-5p	CLIP-seq
MIRT1028025	hsa-miR-4703-5p	CLIP-seq
MIRT1028029	hsa-miR-92a	CLIP-seq
MIRT1028030	hsa-miR-92b	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
ETS1	Activation	12377757
FLI1	Activation	12359731
GATA1	Activation	12377757

Show/Hide all(14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	10822077
GO:0005515	Function	Protein binding	IPI	1715582, 19940238
GO:0005518	Function	Collagen binding	TAS	11027634
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	10822077
GO:0007167	Process	Enzyme linked receptor protein signaling pathway	TAS	9153205
GO:0007596	Process	Blood coagulation	TAS
GO:0009986	Component	Cell surface	HDA	23382103
GO:0030168	Process	Platelet activation	NAS	11027634
GO:0030168	Process	Platelet activation	TAS
GO:0038023	Function	Signaling receptor activity	TAS	11027634
GO:0050900	Process	Leukocyte migration	TAS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0097197	Component	Tetraspanin-enriched microdomain	IDA	18795891

MIM	HGNC	e!Ensembl
605546	14388	ENSG00000088053

Protein

UniProt ID

Q9HCN6

Protein name

Platelet glycoprotein VI (GPVI) (Glycoprotein 6)

Protein function

Collagen receptor involved in collagen-induced platelet adhesion and activation. Plays a key role in platelet procoagulant activity and subsequent thrombin and fibrin formation. This procoagulant function may contribute to arterial and venous th

PDB

2GI7 , 5OU7 , 5OU8 , 5OU9 , 7NMU , 7R58

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13895	Ig_2	27 → 107	Immunoglobulin domain	Domain
PF13895	Ig_2	113 → 202	Immunoglobulin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Megakaryocytes and platelets. {ECO:0000269|PubMed:10961879}.

Sequence

MSPSPTALFCLGLCLGRVPAQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLE
KLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQP
GPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRC
YSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFT
TETSRSITASPKESDSPAGPARQYYTKGNLVRICLGAVILIILAGFLAEDWHSRRKRLRH
RGRAVQRPLPPLPPLPLTRKSNGGQDGGRQDVHSRGLCS

Sequence length

339

Interactions

View interactions

	KEGG		Reactome
	ECM-receptor interaction Platelet activation		GPVI-mediated activation cascade Cell surface interactions at the vascular wall Platelet Adhesion to exposed collagen

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Bleeding disorder	Bleeding diathesis due to glycoprotein VI deficiency	rs121918444, rs398122372, rs398122373, rs773148506, rs1064797083, rs1064797085, rs1064797087, rs761749948

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Evidence	Source
Unknown
Platelet-type bleeding disorder	platelet-type bleeding disorder 11		GenCC
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients	GWAS, CBGDA

Show/Hide Text Mining Associations (57)

Disease Name	Relationship Type	References
Associations from Text Mining
Abortion Habitual	Associate	25086789
Abortion Spontaneous	Associate	25086789
Alzheimer Disease	Associate	32812532
Androgen Insensitivity Syndrome	Associate	34867780
Blood Platelet Disorders	Associate	15010364, 17690106, 18826391, 20526338, 20723028, 23168074, 23580446, 25645904, 26330203, 28300459, 30213874, 30545925, 30721642, 35041713, 35596611, 35955827, 36736831, 37302266 View all (3 more)
Blood Platelet Disorders	Stimulate	28004756
Brain Ischemia	Associate	19686349
Carcinogenesis	Inhibit	32315343
Carcinoma Hepatocellular	Inhibit	38143739
Cardiovascular Diseases	Associate	19686349, 20723028, 23411630, 26330203
Carotid Artery Thrombosis	Associate	28004756
Cerebral Infarction	Associate	23168074
Cognition Disorders	Associate	32812532
Colorectal Neoplasms	Associate	32655010
Coronary Disease	Associate	17105818
Death	Associate	27761580
Diabetes Mellitus	Associate	21854539
Diabetes Mellitus Type 2	Associate	33076381
Endometrial Neoplasms	Associate	32315343
Fetal Diseases	Associate	25086789
Genetic Diseases Inborn	Associate	32917333
Gray Platelet Syndrome	Associate	15010364
Heart Failure	Associate	28953486
Hematologic Diseases	Associate	32098966
Hemorrhage	Associate	12359731, 23815599, 28953486, 35596611
Hemorrhagic Stroke	Associate	35041713
Hyperplasia	Inhibit	32833579
Hypersensitivity Immediate	Associate	23168074
Immunologic Deficiency Syndromes	Inhibit	17059472, 19522742, 32627625
Ischemic Attack Transient	Associate	19686349
Leukemia Lymphocytic Chronic B Cell	Inhibit	34912339
Leukemia Myeloid Acute	Associate	32098966
Melanoma	Associate	1715582
Multiple Sclerosis Chronic Progressive	Stimulate	39613182
Myelodysplastic Syndromes	Associate	32098966
Myocardial Infarction	Associate	19686349, 20227257, 20723028, 25093390, 28004756
Neoplasm Metastasis	Stimulate	32315343
Neoplasms	Associate	32655010, 34290095
Neoplasms Adipose Tissue	Associate	32655010
Noonan Syndrome	Associate	37302266
Obesity	Associate	30658193, 33147989
Papillomavirus Infections	Associate	32859640
Parkinson Disease	Associate	33021140
Prostatic Neoplasms	Associate	23555315
Pulmonary Disease Chronic Obstructive	Inhibit	32440109
Purpura Thrombocytopenic Idiopathic	Associate	35561312
ST Elevation Myocardial Infarction	Associate	28004756
Stroke	Associate	10339462, 19686349
Stroke	Stimulate	35041713
Thrombocytopenia	Associate	36736831
Thrombosis	Associate	17059472, 17690106, 18826391, 19459133, 19686349, 20227257, 22431567, 23815599, 30545925, 30721642, 32627625, 35561312, 35955827, 37302266, 38236412
Uterine Cervical Dysplasia	Associate	36768853
Uterine Cervical Neoplasms	Associate	25743824
Vascular System Injuries	Associate	10468872
Venous Thromboembolism	Associate	19278955, 23150947, 27761580, 37537391
Venous Thrombosis	Associate	18349091
von Willebrand Disease Type 1	Associate	15226188

GP6 (glycoprotein VI platelet)