Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	51203
Gene name	Nucleolar and spindle associated protein 1
Gene symbol	NUSAP1
Synonyms (NCBI Gene)	ANKTBM037LNPNUSAPPRO0310p1Q0310SAPL
Chromosome	15
Chromosome location	15q15.1
Summary	NUSAP1 is a nucleolar-spindle-associated protein that plays a role in spindle microtubule organization (Raemaekers et al., 2003 [PubMed 12963707]).[supplied by OMIM, Jun 2009]

Show/Hide all (86)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052111	hsa-let-7b-5p	CLASH	23622248
MIRT1200221	hsa-miR-1252	CLIP-seq
MIRT1200222	hsa-miR-186	CLIP-seq
MIRT1200223	hsa-miR-3163	CLIP-seq
MIRT1200224	hsa-miR-3662	CLIP-seq
MIRT1200225	hsa-miR-4261	CLIP-seq
MIRT1200226	hsa-miR-4496	CLIP-seq
MIRT1200227	hsa-miR-4733-5p	CLIP-seq
MIRT1200228	hsa-miR-4802-3p	CLIP-seq
MIRT1200229	hsa-miR-494	CLIP-seq
MIRT1200230	hsa-miR-548aa	CLIP-seq
MIRT1200231	hsa-miR-548ac	CLIP-seq
MIRT1200232	hsa-miR-548ae	CLIP-seq
MIRT1200233	hsa-miR-548aj	CLIP-seq
MIRT1200234	hsa-miR-548am	CLIP-seq
MIRT1200235	hsa-miR-548d-3p	CLIP-seq
MIRT1200236	hsa-miR-548x	CLIP-seq
MIRT1200237	hsa-miR-548z	CLIP-seq
MIRT1200238	hsa-miR-587	CLIP-seq
MIRT1200239	hsa-miR-10a	CLIP-seq
MIRT1200240	hsa-miR-10b	CLIP-seq
MIRT1200241	hsa-miR-1185	CLIP-seq
MIRT1200221	hsa-miR-1252	CLIP-seq
MIRT1200242	hsa-miR-128	CLIP-seq
MIRT1200243	hsa-miR-1285	CLIP-seq
MIRT1200244	hsa-miR-2277-3p	CLIP-seq
MIRT1200245	hsa-miR-3117-5p	CLIP-seq
MIRT1200246	hsa-miR-3120-3p	CLIP-seq
MIRT1200247	hsa-miR-3145-3p	CLIP-seq
MIRT1200223	hsa-miR-3163	CLIP-seq
MIRT1200248	hsa-miR-3187-5p	CLIP-seq
MIRT1200249	hsa-miR-339-5p	CLIP-seq
MIRT1200250	hsa-miR-3605-5p	CLIP-seq
MIRT1200251	hsa-miR-3613-3p	CLIP-seq
MIRT1200252	hsa-miR-3679-5p	CLIP-seq
MIRT1200225	hsa-miR-4261	CLIP-seq
MIRT1200253	hsa-miR-4275	CLIP-seq
MIRT1200254	hsa-miR-4282	CLIP-seq
MIRT1200255	hsa-miR-4421	CLIP-seq
MIRT1200226	hsa-miR-4496	CLIP-seq
MIRT1200256	hsa-miR-4524	CLIP-seq
MIRT1200257	hsa-miR-4666-5p	CLIP-seq
MIRT1200258	hsa-miR-4672	CLIP-seq
MIRT1200259	hsa-miR-4725-5p	CLIP-seq
MIRT1200260	hsa-miR-4786-5p	CLIP-seq
MIRT1200228	hsa-miR-4802-3p	CLIP-seq
MIRT1200229	hsa-miR-494	CLIP-seq
MIRT1200261	hsa-miR-504	CLIP-seq
MIRT1200262	hsa-miR-5096	CLIP-seq
MIRT1200263	hsa-miR-520d-5p	CLIP-seq
MIRT1200264	hsa-miR-524-5p	CLIP-seq
MIRT1200265	hsa-miR-545	CLIP-seq
MIRT1200266	hsa-miR-548a-3p	CLIP-seq
MIRT1200267	hsa-miR-548e	CLIP-seq
MIRT1200268	hsa-miR-548f	CLIP-seq
MIRT1200269	hsa-miR-548p	CLIP-seq
MIRT1200270	hsa-miR-593	CLIP-seq
MIRT1200271	hsa-miR-612	CLIP-seq
MIRT1200272	hsa-miR-661	CLIP-seq
MIRT1200273	hsa-miR-769-5p	CLIP-seq
MIRT1200274	hsa-miR-887	CLIP-seq
MIRT1200245	hsa-miR-3117-5p	CLIP-seq
MIRT2057999	hsa-miR-3156-5p	CLIP-seq
MIRT1200223	hsa-miR-3163	CLIP-seq
MIRT2058000	hsa-miR-3919	CLIP-seq
MIRT2058001	hsa-miR-3942-3p	CLIP-seq
MIRT1200256	hsa-miR-4524	CLIP-seq
MIRT1200258	hsa-miR-4672	CLIP-seq
MIRT2058002	hsa-miR-4756-3p	CLIP-seq
MIRT1200238	hsa-miR-587	CLIP-seq
MIRT1200221	hsa-miR-1252	CLIP-seq
MIRT1200225	hsa-miR-4261	CLIP-seq
MIRT1200226	hsa-miR-4496	CLIP-seq
MIRT1200228	hsa-miR-4802-3p	CLIP-seq
MIRT1200229	hsa-miR-494	CLIP-seq
MIRT2455567	hsa-miR-3976	CLIP-seq
MIRT2455568	hsa-miR-4693-3p	CLIP-seq
MIRT2455569	hsa-miR-4709-3p	CLIP-seq
MIRT2584291	hsa-miR-3148	CLIP-seq
MIRT1200254	hsa-miR-4282	CLIP-seq
MIRT1200263	hsa-miR-520d-5p	CLIP-seq
MIRT1200264	hsa-miR-524-5p	CLIP-seq
MIRT2584291	hsa-miR-3148	CLIP-seq
MIRT1200254	hsa-miR-4282	CLIP-seq
MIRT1200263	hsa-miR-520d-5p	CLIP-seq
MIRT1200264	hsa-miR-524-5p	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	IDA	12963707
GO:0000226	Process	Microtubule cytoskeleton organization	IEA
GO:0000281	Process	Mitotic cytokinesis	IBA
GO:0000281	Process	Mitotic cytokinesis	IDA	12963707
GO:0000281	Process	Mitotic cytokinesis	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	25416956, 39212774
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0007076	Process	Mitotic chromosome condensation	IBA
GO:0007076	Process	Mitotic chromosome condensation	IDA	12963707
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0040001	Process	Establishment of mitotic spindle localization	IBA
GO:0040001	Process	Establishment of mitotic spindle localization	IDA	12963707
GO:0040001	Process	Establishment of mitotic spindle localization	IEA
GO:0045840	Process	Positive regulation of mitotic nuclear division	IDA	12963707
GO:0051301	Process	Cell division	IEA
GO:0072686	Component	Mitotic spindle	IBA
GO:0072686	Component	Mitotic spindle	IEA

MIM	HGNC	e!Ensembl
612818	18538	ENSG00000137804

Q9BXS6

Protein name

Nucleolar and spindle-associated protein 1 (NuSAP)

Protein function

Microtubule-associated protein with the capacity to bundle and stabilize microtubules (By similarity). May associate with chromosomes and promote the organization of mitotic spindle microtubules around them. {ECO:0000250, ECO:0000269|PubMed:1296

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16006	NUSAP	158 → 436	Nucleolar and spindle-associated protein	Family

Sequence

MIIPSLEELDSLKYSDLQNLAKSLGLRANLRATKLLKALKGYIKHEARKGNENQDESQTS
ASSCDETEIQISNQEEAERQPLGHVTKTRRRCKTVRVDPDSQQNHSEIKISNPTEFQNHE
KQESQDLRATAKVPSPPDEHQEAENAVSSGNRDSKVPSEGKKSLYTDESSKPGKNKRTAI
TTPNFKKLHEAHFKEMESIDQYIERKKKHFEEHNSMNELKQQPINKGGVRTPVPPRGRLS
VASTPISQRRSQGRSCGPASQSTLGLKGSLKRSAISAAKTGVRFSAATKDNEHKRSLTKT
PARKSAHVTVSGGTPKGEAVLGTHKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDL
KASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQTKEEQRKKREQ
ERKEKKAKVLGMRRGLILAED

Sequence length

441

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Microcephaly, seizures, and developmental delay	Likely pathogenic	rs2140875089	RCV002255108	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (47)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	37047232	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	37752167, 39781524	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blind Loop Syndrome	Associate	37047232	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	25756514, 26485712, 30476929, 31895772, 31901150, 32651974, 34384030, 36096037, 37713876	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	26554377, 31901150, 33126319	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	31746405, 31901150, 32046048, 33784984, 34238253, 36882493	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	33126319	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Associate	35739489	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	38229038	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	31469863	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental Disabilities	Associate	37005340	★★★★★ ★☆☆☆☆ Found in Text Mining only
DNA Virus Infections	Associate	37047232	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Associate	37005340	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	30356407, 33423377	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	29336114	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypomagnesemia primary	Associate	23405241	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Associate	37781040	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	20053754	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	34782617	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	20053754, 30480765	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Stimulate	35487972, 39980241	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	35710427	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Non Hodgkin	Associate	36945359, 37828118	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	17611626, 37781040	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Associate	21157382	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Associate	33032291	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Associate	37005340	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Stimulate	30678687	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	35485274, 37047232	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	15260889, 20053754, 29336114, 31901150, 32651974, 34782617, 35710427, 35739489, 36637953, 37596700, 37713876, 37781040, 38229038, 39781524, 39980241	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	26554377	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	30678687, 37047232	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteochondritis	Associate	31758856	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	31729978, 35739489, 37304238	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	32420375, 36401386	★★★★★ ★☆☆☆☆ Found in Text Mining only
Personality Disorders	Associate	21157382	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	22349817, 37047232	★★★★★ ★☆☆☆☆ Found in Text Mining only
Recombinant chromosome 8 syndrome	Associate	38229038	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Associate	37005340	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	26554377, 33285674, 39980241	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Associate	35710427	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Associate	33025856, 33455115	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	26485712	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	31901150, 35487972	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	23405241, 31901150	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Stimulate	30678687	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Associate	35485274	★★★★★ ★☆☆☆☆ Found in Text Mining only

NUSAP1 (nucleolar and spindle associated protein 1)