Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51164
Gene name Gene Name - the full gene name approved by the HGNC.
Dynactin subunit 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DCTN4
Synonyms (NCBI Gene) Gene synonyms aliases
DYN4, P62
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q33.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT021605 hsa-miR-142-3p Microarray 17612493
MIRT028163 hsa-miR-93-5p Sequencing 20371350
MIRT045463 hsa-miR-149-5p CLASH 23622248
MIRT043893 hsa-miR-378a-3p CLASH 23622248
MIRT042076 hsa-miR-484 CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000776 Component Kinetochore IEA
GO:0000922 Component Spindle pole IEA
GO:0001725 Component Stress fiber IEA
GO:0005515 Function Protein binding IPI 16554302, 21516116, 25416956, 26871637, 32296183, 32814053
GO:0005634 Component Nucleus TAS 10671518
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614758 15518 ENSG00000132912
Protein
UniProt ID Q9UJW0
Protein name Dynactin subunit 4 (Dyn4) (Dynactin subunit p62)
Protein function Part of the dynactin complex that activates the molecular motor dynein for ultra-processive transport along microtubules.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05502 Dynactin_p62 23 181 Dynactin p62 family Family
PF05502 Dynactin_p62 141 375 Dynactin p62 family Family
Sequence
MASLLQSDRVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPS
AEAKLKKNRCANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRD
VGMADKSVASGGWQEPENPH
TQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSD
K
YGLGTRLQRPRAGASISTLAGLSLKEGEDQKEIKIEPAQAVDEVEPLPEDYYTRPVNLT
EVTTLQQRLLQPDFQPVCASQLYPRHKHLLIKRSLRCRKCEHNLSKPEFNPTSIKFKIQL
VAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLFECEEGDPDDINSTAKVVV
PPKELVLAGKDAAAE
YDELAEPQDFQDDPDIIAFRKANKVGIFIKVTPQREEGEVTVCFK
MKHDFKNLAAPIRPIEESDQGTEVIWLTQHVELSLGPLLP
Sequence length 460
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Motor proteins
Vasopressin-regulated water reabsorption
Amyotrophic lateral sclerosis
Huntington disease
Pathways of neurodegeneration - multiple diseases
Salmonella infection
  MHC class II antigen presentation
HSP90 chaperone cycle for steroid hormone receptors (SHR)
COPI-mediated anterograde transport
COPI-independent Golgi-to-ER retrograde traffic
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Cystic Fibrosis cystic fibrosis N/A N/A GenCC
Lung adenocarcinoma Lung adenocarcinoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Cystic Fibrosis Associate 26047157
Lymphoma Non Hodgkin Associate 33896271
Neoplasms Associate 33896271, 35715770
Ovarian Neoplasms Associate 35281472
Rectal Neoplasms Associate 35409691
Squamous Cell Carcinoma of Head and Neck Associate 35715770