Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	51157
Gene name	Zinc finger protein 580
Gene symbol	ZNF580
Synonyms (NCBI Gene)	-
Chromosome	19
Chromosome location	19q13.42

165

Show/Hide all (165)

miRTarBase ID	miRNA	Experiments
MIRT1530524	hsa-miR-1	CLIP-seq
MIRT1530525	hsa-miR-1207-3p	CLIP-seq
MIRT1530526	hsa-miR-122	CLIP-seq
MIRT1530527	hsa-miR-1252	CLIP-seq
MIRT1530528	hsa-miR-1321	CLIP-seq
MIRT1530529	hsa-miR-1322	CLIP-seq
MIRT1530530	hsa-miR-1915	CLIP-seq
MIRT1530531	hsa-miR-204	CLIP-seq
MIRT1530532	hsa-miR-206	CLIP-seq
MIRT1530533	hsa-miR-211	CLIP-seq
MIRT1530534	hsa-miR-2110	CLIP-seq
MIRT1530535	hsa-miR-3130-5p	CLIP-seq
MIRT1530536	hsa-miR-3155	CLIP-seq
MIRT1530537	hsa-miR-3155b	CLIP-seq
MIRT1530538	hsa-miR-3184	CLIP-seq
MIRT1530539	hsa-miR-3202	CLIP-seq
MIRT1530540	hsa-miR-342-3p	CLIP-seq
MIRT1530541	hsa-miR-3614-5p	CLIP-seq
MIRT1530542	hsa-miR-377	CLIP-seq
MIRT1530543	hsa-miR-378	CLIP-seq
MIRT1530544	hsa-miR-378b	CLIP-seq
MIRT1530545	hsa-miR-378c	CLIP-seq
MIRT1530546	hsa-miR-378d	CLIP-seq
MIRT1530547	hsa-miR-378e	CLIP-seq
MIRT1530548	hsa-miR-378f	CLIP-seq
MIRT1530549	hsa-miR-378h	CLIP-seq
MIRT1530550	hsa-miR-378i	CLIP-seq
MIRT1530551	hsa-miR-422a	CLIP-seq
MIRT1530552	hsa-miR-423-5p	CLIP-seq
MIRT1530553	hsa-miR-4268	CLIP-seq
MIRT1530554	hsa-miR-4270	CLIP-seq
MIRT1530555	hsa-miR-4271	CLIP-seq
MIRT1530556	hsa-miR-4284	CLIP-seq
MIRT1530557	hsa-miR-4287	CLIP-seq
MIRT1530558	hsa-miR-4438	CLIP-seq
MIRT1530559	hsa-miR-4441	CLIP-seq
MIRT1530560	hsa-miR-4448	CLIP-seq
MIRT1530561	hsa-miR-4461	CLIP-seq
MIRT1530562	hsa-miR-4476	CLIP-seq
MIRT1530563	hsa-miR-4482	CLIP-seq
MIRT1530564	hsa-miR-4533	CLIP-seq
MIRT1530565	hsa-miR-4649-3p	CLIP-seq
MIRT1530566	hsa-miR-4685-3p	CLIP-seq
MIRT1530567	hsa-miR-4688	CLIP-seq
MIRT1530568	hsa-miR-4725-3p	CLIP-seq
MIRT1530569	hsa-miR-4726-3p	CLIP-seq
MIRT1530570	hsa-miR-4728-5p	CLIP-seq
MIRT1530571	hsa-miR-4738-3p	CLIP-seq
MIRT1530572	hsa-miR-4739	CLIP-seq
MIRT1530573	hsa-miR-4756-5p	CLIP-seq
MIRT1530574	hsa-miR-484	CLIP-seq
MIRT1530575	hsa-miR-491-5p	CLIP-seq
MIRT1530576	hsa-miR-555	CLIP-seq
MIRT1530577	hsa-miR-613	CLIP-seq
MIRT1530578	hsa-miR-891a	CLIP-seq
MIRT1530525	hsa-miR-1207-3p	CLIP-seq
MIRT2160389	hsa-miR-124	CLIP-seq
MIRT1530527	hsa-miR-1252	CLIP-seq
MIRT2160390	hsa-miR-1303	CLIP-seq
MIRT1530529	hsa-miR-1322	CLIP-seq
MIRT2160391	hsa-miR-133a	CLIP-seq
MIRT2160392	hsa-miR-133b	CLIP-seq
MIRT2160393	hsa-miR-139-3p	CLIP-seq
MIRT2160394	hsa-miR-214	CLIP-seq
MIRT2160395	hsa-miR-2682	CLIP-seq
MIRT2160396	hsa-miR-3150a-5p	CLIP-seq
MIRT2160397	hsa-miR-3150b-5p	CLIP-seq
MIRT1530536	hsa-miR-3155	CLIP-seq
MIRT1530537	hsa-miR-3155b	CLIP-seq
MIRT1530540	hsa-miR-342-3p	CLIP-seq
MIRT1530541	hsa-miR-3614-5p	CLIP-seq
MIRT2160398	hsa-miR-3618	CLIP-seq
MIRT2160399	hsa-miR-3619-5p	CLIP-seq
MIRT2160400	hsa-miR-3714	CLIP-seq
MIRT1530542	hsa-miR-377	CLIP-seq
MIRT2160401	hsa-miR-3910	CLIP-seq
MIRT1530556	hsa-miR-4284	CLIP-seq
MIRT2160402	hsa-miR-4291	CLIP-seq
MIRT1530558	hsa-miR-4438	CLIP-seq
MIRT1530562	hsa-miR-4476	CLIP-seq
MIRT2160403	hsa-miR-449c	CLIP-seq
MIRT1530564	hsa-miR-4533	CLIP-seq
MIRT2160404	hsa-miR-483-5p	CLIP-seq
MIRT1530574	hsa-miR-484	CLIP-seq
MIRT2160405	hsa-miR-499-3p	CLIP-seq
MIRT2160406	hsa-miR-499a-3p	CLIP-seq
MIRT2160407	hsa-miR-506	CLIP-seq
MIRT1530576	hsa-miR-555	CLIP-seq
MIRT2160408	hsa-miR-601	CLIP-seq
MIRT2160409	hsa-miR-668	CLIP-seq
MIRT2160410	hsa-miR-761	CLIP-seq
MIRT2160411	hsa-miR-9	CLIP-seq
MIRT2160412	hsa-miR-922	CLIP-seq
MIRT1530525	hsa-miR-1207-3p	CLIP-seq
MIRT2379681	hsa-miR-1236	CLIP-seq
MIRT1530527	hsa-miR-1252	CLIP-seq
MIRT2379682	hsa-miR-1268	CLIP-seq
MIRT2379683	hsa-miR-1268b	CLIP-seq
MIRT1530528	hsa-miR-1321	CLIP-seq
MIRT1530529	hsa-miR-1322	CLIP-seq
MIRT2160391	hsa-miR-133a	CLIP-seq
MIRT2160392	hsa-miR-133b	CLIP-seq
MIRT2379684	hsa-miR-147	CLIP-seq
MIRT1530530	hsa-miR-1915	CLIP-seq
MIRT1530535	hsa-miR-3130-5p	CLIP-seq
MIRT2379685	hsa-miR-3132	CLIP-seq
MIRT2379686	hsa-miR-3166	CLIP-seq
MIRT2379687	hsa-miR-3179	CLIP-seq
MIRT1530538	hsa-miR-3184	CLIP-seq
MIRT1530539	hsa-miR-3202	CLIP-seq
MIRT2160398	hsa-miR-3618	CLIP-seq
MIRT1530542	hsa-miR-377	CLIP-seq
MIRT2379688	hsa-miR-3911	CLIP-seq
MIRT2379689	hsa-miR-3935	CLIP-seq
MIRT1530552	hsa-miR-423-5p	CLIP-seq
MIRT1530554	hsa-miR-4270	CLIP-seq
MIRT1530559	hsa-miR-4441	CLIP-seq
MIRT1530562	hsa-miR-4476	CLIP-seq
MIRT1530563	hsa-miR-4482	CLIP-seq
MIRT2379690	hsa-miR-4488	CLIP-seq
MIRT1530564	hsa-miR-4533	CLIP-seq
MIRT1530567	hsa-miR-4688	CLIP-seq
MIRT2379691	hsa-miR-4697-5p	CLIP-seq
MIRT1530569	hsa-miR-4726-3p	CLIP-seq
MIRT1530570	hsa-miR-4728-5p	CLIP-seq
MIRT1530572	hsa-miR-4739	CLIP-seq
MIRT1530573	hsa-miR-4756-5p	CLIP-seq
MIRT2379692	hsa-miR-4787-5p	CLIP-seq
MIRT2160405	hsa-miR-499-3p	CLIP-seq
MIRT2160406	hsa-miR-499a-3p	CLIP-seq
MIRT1530576	hsa-miR-555	CLIP-seq
MIRT2160408	hsa-miR-601	CLIP-seq
MIRT2379693	hsa-miR-644	CLIP-seq
MIRT1530578	hsa-miR-891a	CLIP-seq
MIRT2160411	hsa-miR-9	CLIP-seq
MIRT2441860	hsa-miR-1291	CLIP-seq
MIRT2379684	hsa-miR-147	CLIP-seq
MIRT2441861	hsa-miR-328	CLIP-seq
MIRT2379688	hsa-miR-3911	CLIP-seq
MIRT2441862	hsa-miR-4494	CLIP-seq
MIRT2441863	hsa-miR-499a-5p	CLIP-seq
MIRT2379693	hsa-miR-644	CLIP-seq
MIRT2441864	hsa-miR-663b	CLIP-seq
MIRT1530528	hsa-miR-1321	CLIP-seq
MIRT2160391	hsa-miR-133a	CLIP-seq
MIRT2160392	hsa-miR-133b	CLIP-seq
MIRT1530530	hsa-miR-1915	CLIP-seq
MIRT1530535	hsa-miR-3130-5p	CLIP-seq
MIRT1530538	hsa-miR-3184	CLIP-seq
MIRT2160398	hsa-miR-3618	CLIP-seq
MIRT1530542	hsa-miR-377	CLIP-seq
MIRT1530552	hsa-miR-423-5p	CLIP-seq
MIRT1530554	hsa-miR-4270	CLIP-seq
MIRT1530559	hsa-miR-4441	CLIP-seq
MIRT1530563	hsa-miR-4482	CLIP-seq
MIRT1530567	hsa-miR-4688	CLIP-seq
MIRT1530569	hsa-miR-4726-3p	CLIP-seq
MIRT1530570	hsa-miR-4728-5p	CLIP-seq
MIRT1530572	hsa-miR-4739	CLIP-seq
MIRT1530573	hsa-miR-4756-5p	CLIP-seq
MIRT2160405	hsa-miR-499-3p	CLIP-seq
MIRT2160406	hsa-miR-499a-3p	CLIP-seq
MIRT2160408	hsa-miR-601	CLIP-seq
MIRT1530578	hsa-miR-891a	CLIP-seq
MIRT2160411	hsa-miR-9	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	20382120
GO:0002690	Process	Positive regulation of leukocyte chemotaxis	IDA	21830064
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	21599657, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	20382120, 21599657
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	20382120
GO:0010628	Process	Positive regulation of gene expression	IDA	20382120, 21830064
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	21830064
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	IDA	21830064
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
617888	29473	ENSG00000213015

Q9UK33

Protein name

Zinc finger protein 580 (LDL-induced EC protein)

Protein function

Involved in the regulation of endothelial cell proliferation and migration. Mediates H(2)O(2)-induced leukocyte chemotaxis by elevating interleukin-8 production and may play a role in inflammation. May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	120 → 142	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	150 → 172	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in endothelial cells. {ECO:0000269|PubMed:21599657}.

Sequence

MLLLPPRPPHPRSSSPEAMDPPPPKAPPFPKAEGPSSTPSSAAGPRPPRLGRHLLIDANG
VPYTYTVQLEEEPRGPPQREAPPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPF
TCGACGKAFKRSSHLSRHRATHRARAGPPHTCPLCPRRFQDAAELAQHVRLH

Sequence length

172

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Hepatocellular	Associate	36524545	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Associate	36524545	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF580 (zinc finger protein 580)