Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51150
Gene name Gene Name - the full gene name approved by the HGNC.
Stromal cell derived factor 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SDF4
Synonyms (NCBI Gene) Gene synonyms aliases
Cab45, SDF-4
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a stromal cell derived factor that is a member of the CREC protein family. The encoded protein contains six EF-hand motifs and calcium-binding motifs. This protein localizes to the Golgi lumen and may be involved in regulating calcium de
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT043980 hsa-miR-378a-5p CLASH 23622248
MIRT042088 hsa-miR-484 CLASH 23622248
MIRT461032 hsa-miR-9500 PAR-CLIP 23592263
MIRT461031 hsa-miR-6134 PAR-CLIP 23592263
MIRT461030 hsa-miR-6820-5p PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IBA 21873635
GO:0005509 Function Calcium ion binding ISS
GO:0005515 Function Protein binding IPI 32814053
GO:0005737 Component Cytoplasm ISS 17442889
GO:0005770 Component Late endosome ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614282 24188 ENSG00000078808
Protein
UniProt ID Q9BRK5
Protein name 45 kDa calcium-binding protein (Cab45) (Stromal cell-derived factor 4) (SDF-4)
Protein function May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment. ; Isoform 5 may be involved in the exocytosis of zymogens by pancreatic acini.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13499 EF-hand_7 90 167 EF-hand domain pair Domain
PF13202 EF-hand_5 288 307 EF hand Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Isoform 5 is expressed in pancreas. {ECO:0000269|PubMed:17442889}.
Sequence
MVWPWVAMASRWGPLIGLAPCCLWLLGAVLLMDASARPANHSSTRERVANREENEILPPD
HLNGVKLEMDGHLNRGFHQEVFLGKDLGGFDEDAEPRRSRRKLMVIFSKVDVNTDRKISA
KEMQRWIMEKTAEHFQEAMEESKTHFRAVDPDGDGHVSWDEYKVKFL
ASKGHSEKEVADA
IRLNEELKVDEETQEVLENLKDRWYQADSPPADLLLTEEEFLSFLHPEHSRGMLRFMVKE
IVRDLDQDGDKQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTA
EELESYM
DPMNEYNALNEAKQMIAVADENQNHHLEPEEVLKYSEFFTGSKLVDYARSVHE
EF
Sequence length 362
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
21743468
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 19513569
Calcinosis Cutis Inhibit 19513569
Death Inhibit 19513569
Nasopharyngeal Carcinoma Associate 36606322
Neoplasms Associate 27194945, 36606322
Pancreatic Neoplasms Associate 16215274