Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51149
Gene name Gene Name - the full gene name approved by the HGNC.
MRN complex interacting protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MRNIP
Synonyms (NCBI Gene) Gene synonyms aliases
C5orf45
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q35.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT690227 hsa-miR-34b-3p HITS-CLIP 23313552
MIRT636899 hsa-miR-216a-5p HITS-CLIP 23313552
MIRT690226 hsa-miR-216b-5p HITS-CLIP 23313552
MIRT690225 hsa-miR-3929 HITS-CLIP 23313552
MIRT690224 hsa-miR-4419b HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003682 Function Chromatin binding IDA 27568553
GO:0005515 Function Protein binding IPI 27568553, 32296183
GO:0005634 Component Nucleus IDA 27568553
GO:0005654 Component Nucleoplasm IDA 27568553
GO:0006281 Process DNA repair IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
617154 30817 ENSG00000161010
Protein
UniProt ID Q6NTE8
Protein name MRN complex-interacting protein (MRN-interacting protein)
Protein function Plays a role in the cellular response to DNA damage and the maintenance of genome stability through its association with the MRN damage-sensing complex (PubMed:27568553). Promotes chromatin loading and activity of the MRN complex to facilitate s
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15749 MRNIP 9 110 MRN-interacting protein Family
Sequence
MASLQRSRVLRCCSCRLFQAHQVKKSVKWTCKACGEKQSFLQAYGEGSGADCRRHVQKLN
LLQGQVSELPLRSLEETVSASEEENVGHQQAGNVKQQEKSQPSESRWLKY
LEKDSQELEL
EGTGVCFSKQPSSKMEEPGPRFSQDLPRKRKWSRSTVQPPCSRGVQDSGGSEVAWGPQKG
QAGLTWKVKQGSSPCLQENSADCSAGELRGPGKELWSPIQQVTATSSKWAQFVLPPRKSS
HVDSEQPRSLQRDPRPAGPAQAKQGTPRAQASREGLSRPTAAVQLPRATHPVTSGSERPC
GKTSWDARTPWAEGGPLVLEAQNPRPTRLCDLFITGEDFDDDV
Sequence length 343
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Frontotemporal dementia with or without amyotrophic lateral sclerosis FRONTOTEMPORAL DEMENTIA AND/OR AMYOTROPHIC LATERAL SCLEROSIS 3 rs63751126, rs63750355, rs121909334, rs387906789, rs387906790, rs281864934, rs63750652, rs587777574, rs143561967, rs876657404, rs876657405, rs876657406, rs755950225, rs767898276, rs748112833
View all (12 more)
18765443, 23942205, 11992264, 24899140, 21515589, 23417734, 19589897, 24042580, 21195346, 25241215, 15493999
Paget disease PAGET DISEASE OF BONE 3 rs796051862, rs796051869, rs796051870, rs796052213, rs1555767678, rs869025582 21878516, 24899140, 18543015, 11992264, 19589897, 15647816, 24042580, 20499339, 21195346, 23942205, 15176995, 18765443, 19257822, 15493999, 23417734
View all (6 more)
Associations from Text Mining
Disease Name Relationship Type References
Osteitis Deformans Associate 19925894