Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51095
Gene name Gene Name - the full gene name approved by the HGNC.
TRNA nucleotidyl transferase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRNT1
Synonyms (NCBI Gene) Gene synonyms aliases
CCA1, CGI-47, MtCCA, RPEM, SIFD
Disease Acronyms (UniProt) Disease acronyms from UniProt database
RPEM, SIFD
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p26.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a CCA-adding enzyme which belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. This essential enzyme functions by catalyzing the addition of the conserved nucleotide triplet CCA to the 3` terminus of tR
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs370011798 T>C Pathogenic Missense variant, intron variant, coding sequence variant, genic downstream transcript variant, non coding transcript variant
rs606231287 G>C,T Pathogenic Missense variant, genic downstream transcript variant, coding sequence variant, non coding transcript variant
rs606231289 T>C Pathogenic Missense variant, genic downstream transcript variant, coding sequence variant, non coding transcript variant
rs606231290 C>T Pathogenic Missense variant, coding sequence variant, non coding transcript variant, intron variant, genic downstream transcript variant
rs761516140 C>G,T Pathogenic Non coding transcript variant, missense variant, coding sequence variant, genic downstream transcript variant, intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT032454 hsa-let-7b-5p Proteomics 18668040
MIRT447873 hsa-miR-3168 PAR-CLIP 22100165
MIRT447872 hsa-miR-148b-5p PAR-CLIP 22100165
MIRT447871 hsa-miR-6874-3p PAR-CLIP 22100165
MIRT447870 hsa-miR-5584-3p PAR-CLIP 22100165
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000049 Function TRNA binding IDA 11504732
GO:0001680 Process TRNA 3'-terminal CCA addition IDA 25193871
GO:0005524 Function ATP binding TAS 11504732
GO:0005654 Component Nucleoplasm TAS
GO:0005739 Component Mitochondrion IDA 11504732
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612907 17341 ENSG00000072756
Protein
UniProt ID Q96Q11
Protein name CCA tRNA nucleotidyltransferase 1, mitochondrial (EC 2.7.7.72) (Mitochondrial tRNA nucleotidyl transferase, CCA-adding) (mt CCA-adding enzyme) (mt tRNA CCA-diphosphorylase) (mt tRNA CCA-pyrophosphorylase) (mt tRNA adenylyltransferase)
Protein function Nucleotidyltransferase that catalyzes the addition and repair of the essential 3'-terminal CCA sequence in tRNAs, which is necessary for the attachment of amino acids to the 3' terminus of tRNA molecules, using CTP and ATP as substrates (PubMed:
PDB 1OU5 , 4X4W , 8CBM
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01743 PolyA_pol 59 182 Poly A polymerase head domain Domain
PF12627 PolyA_pol_RNAbd 215 272 Probable RNA and SrmB- binding site of polymerase A Domain
Sequence
MLRCLYHWHRPVLNRRWSRLCLPKQYLFTMKLQSPEFQSLFTEGLKSLTELFVKENHELR
IAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENF
EITTLRIDVTTDGRHAEVEFTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKK
VR
FVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIWV
ELKKILVGNHVNHLIHLIYDLDVAPYIGLPAN
ASLEEFDKVSKNVDGFSPKPVTLLASLF
KVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATT
RVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIRKVGISSGKEIGALLQQLREQWKKSGY
QMEKDELLSYIKKT
Sequence length 434
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    tRNA processing in the nucleus
tRNA processing in the mitochondrion
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Anemia Anemia, Microcytic hypochromic anemia (disorder) rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966
View all (89 more)
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Elliptocytosis Elliptocytosis, Hereditary rs121918645, rs863223302, rs863223303, rs1594753904, rs121918647, rs121918648, rs121918650, rs121918634, rs757679761, rs121918637, rs121918638, rs121918640, rs121918641, rs121918642, rs863223305
View all (1 more)
Myopia Myopia rs387907109, rs146936371, rs587776903, rs786205127, rs398122836, rs199624584, rs587777625, rs786205216, rs758872875, rs764211125, rs1135402746, rs765658563, rs1555941129, rs1555941116, rs199923805
View all (6 more)
Unknown
Disease term Disease name Evidence References Source
Sideroblastic Anemia congenital sideroblastic anemia-B-cell immunodeficiency-periodic fever-developmental delay syndrome GenCC
Retinitis Pigmentosa And Erythrocytic Microcytosis retinitis pigmentosa and erythrocytic microcytosis GenCC
Associations from Text Mining
Disease Name Relationship Type References
Acidosis Lactic Associate 25652405
Anemia Hemolytic Associate 31338833
Anemia Sideroblastic Associate 25193871, 25652405, 27317422, 33936027, 36729249, 37239403
Atrophy Associate 25652405
Breast Neoplasms Associate 31512554
Cardiomyopathies Associate 33484326
Colorectal Neoplasms Associate 22276153
Common Variable Immunodeficiency Associate 33859323
Death Associate 29358286
Developmental Disabilities Associate 25652405, 27317422, 29055896, 37239403