Gene Gene information from NCBI Gene database.
Entrez ID 51082
Gene name RNA polymerase I and III subunit D
Gene symbol POLR1D
Synonyms (NCBI Gene)
AC19POLR1CRPA16RPA9RPAC2RPC16RPO1-3TCS2
Chromosome 13
Chromosome location 13q12.2
Summary The protein encoded by this gene is a component of the RNA polymerase I and RNA polymerase III complexes, which function in the synthesis of ribosomal RNA precursors and small RNAs, respectively. Mutations in this gene are a cause of Treacher Collins synd
SNPs SNP information provided by dbSNP.
2
SNP ID Visualize variation Clinical significance Consequence
rs1593275599 C>T Pathogenic Genic upstream transcript variant, stop gained, coding sequence variant, intron variant
rs1593275616 ->GG Pathogenic Genic upstream transcript variant, frameshift variant, coding sequence variant, intron variant
miRNA miRNA information provided by mirtarbase database.
187
miRTarBase ID miRNA Experiments Reference
MIRT027718 hsa-miR-98-5p Microarray 19088304
MIRT038262 hsa-miR-374a-3p CLASH 23622248
MIRT640828 hsa-miR-589-3p HITS-CLIP 19536157
MIRT640827 hsa-miR-186-3p HITS-CLIP 19536157
MIRT640828 hsa-miR-589-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
GO ID Ontology Definition Evidence Reference
GO:0000428 Component DNA-directed RNA polymerase complex IEA
GO:0003677 Function DNA binding IEA
GO:0003899 Function DNA-directed RNA polymerase activity IBA
GO:0003899 Function DNA-directed RNA polymerase activity IEA
GO:0005515 Function Protein binding IPI 16189514, 21988832, 25416956, 32296183, 32814053, 33961781, 35271311
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
613715 20422 ENSG00000186184
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0DPB6
Protein name DNA-directed RNA polymerases I and III subunit RPAC2 (RNA polymerases I and III subunit AC2) (AC19) (DNA-directed RNA polymerase I subunit D) (RNA polymerase I 16 kDa subunit) (RPA16) (RPC16) (hRPA19)
Protein function DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and short non-coding RNAs
PDB 7A6H , 7AE1 , 7AE3 , 7AEA , 7AST , 7D58 , 7D59 , 7DN3 , 7DU2 , 7FJI , 7FJJ , 7OB9 , 7OBA , 7OBB , 7VBA , 7VBB , 7VBC , 8A43 , 8ITY , 8IUE , 8IUH , 9FSO , 9FSP , 9FSQ , 9FSR , 9FSS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13656 RNA_pol_L_2 39 113 RNA polymerase Rpb3/Rpb11 dimerisation domain Domain
Sequence
MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIM
KNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDK
FEASIKD
YKDQKASRNESTF
Sequence length 133
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0DPB5
Protein name Protein POLR1D, isoform 2
Family and domains
Sequence
MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKE
QDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSN
RR
Sequence length 122
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  RNA polymerase
Cytosolic DNA-sensing pathway
  Cytosolic sensors of pathogen-associated DNA
B-WICH complex positively regulates rRNA expression
RNA Polymerase I Transcription Initiation
RNA Polymerase I Promoter Escape
RNA Polymerase I Transcription Termination
RNA Polymerase III Transcription Initiation From Type 1 Promoter
RNA Polymerase III Transcription Initiation From Type 2 Promoter
RNA Polymerase III Transcription Initiation From Type 3 Promoter
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
27
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
POLR1D-related disorder Likely pathogenic rs2500475304, rs2500474635 RCV003402567
RCV003894390
Treacher Collins syndrome Pathogenic rs587777841 RCV003319179
Treacher Collins syndrome 2 Pathogenic; Likely pathogenic rs587777841, rs2138519077, rs2500474424, rs2500474235, rs1593275599, rs767196650, rs1593275448, rs2138519194, rs1593275616, rs1593275363 RCV000144520
RCV002269139
RCV002283731
RCV002474262
RCV000024043
RCV000024044
RCV000024045
RCV000024046
RCV000024047
RCV000024048
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs73432869 RCV005915777
Cholangiocarcinoma Benign rs73432869 RCV005915779
Hearing impairment Uncertain significance rs2138519035 RCV001375417
Sarcoma Benign rs73432869 RCV005915778
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Colorectal Neoplasms Associate 19359472, 32087735
Kininogen Deficiency High Molecular Weight and Low Molecular Weight Associate 25790162
Mandibulofacial Dysostosis Associate 24603435, 25790162, 31307516, 32537850, 37222571, 39518953
Multiple Sclerosis Associate 23077530
Neoplasms Inhibit 19359472
Parkinson Disease Associate 31199560
Squamous Cell Carcinoma of Head and Neck Associate 38256104