Gene Gene information from NCBI Gene database.
Entrez ID 51062
Gene name Atlastin GTPase 1
Gene symbol ATL1
Synonyms (NCBI Gene)
AD-FSPATL-1FSP1GBP3HSN1DSPG3SPG3Aatlastin1
Chromosome 14
Chromosome location 14q22.1
Summary The protein encoded by this gene is a GTPase and a Golgi body transmembrane protein. The encoded protein can form a homotetramer and has been shown to interact with spastin and with mitogen-activated protein kinase kinase kinase kinase 4. This protein may
SNPs SNP information provided by dbSNP.
42
SNP ID Visualize variation Clinical significance Consequence
rs28939094 A>G,T Uncertain-significance, likely-pathogenic Coding sequence variant, missense variant
rs119476046 C>T Pathogenic, pathogenic-likely-pathogenic Missense variant, coding sequence variant
rs119476047 C>A Pathogenic Missense variant, coding sequence variant
rs119476048 A>G Pathogenic Missense variant, coding sequence variant
rs119476049 G>A Likely-pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
16
miRTarBase ID miRNA Experiments Reference
MIRT018361 hsa-miR-335-5p Microarray 18185580
MIRT021430 hsa-miR-9-5p Microarray 17612493
MIRT051409 hsa-let-7f-5p CLASH 23622248
MIRT805782 hsa-miR-1272 CLIP-seq
MIRT805783 hsa-miR-1322 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
34
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0000166 Function Nucleotide binding IEA
GO:0003924 Function GTPase activity IBA
GO:0003924 Function GTPase activity IEA
GO:0005515 Function Protein binding IPI 16815977, 19665976, 20200447, 23969831, 25751282, 32814053
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606439 11231 ENSG00000198513
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WXF7
Protein name Atlastin-1 (ATL-1) (EC 3.6.5.-) (Brain-specific GTP-binding protein) (GTP-binding protein 3) (GBP-3) (hGBP3) (Guanine nucleotide-binding protein 3) (Spastic paraplegia 3 protein A)
Protein function Atlastin-1 (ATL1) is a membrane-anchored GTPase that mediates the GTP-dependent fusion of endoplasmic reticulum (ER) membranes, maintaining the continuous ER network. It facilitates the formation of three-way junctions where ER tubules intersect
PDB 3Q5D , 3Q5E , 3QNU , 3QOF , 4IDN , 4IDO , 4IDP , 4IDQ , 6B9D , 6B9E , 6B9F , 6B9G , 6XJN , 7OL3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02263 GBP 43 314 Guanylate-binding protein, N-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed predominantly in the adult and fetal central nervous system. Measurable expression in all tissues examined, although expression in adult brain is at least 50-fold higher than in other tissues. Detected predominantly in pyrami
Sequence
MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDETALNRILLSE
AVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERET
TGIQIWSEIFLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQ
NVQEDDLQHLQLFTEYGRLAMEETFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRL
KVSGNQHEELQNVRKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKIL
IPWLLSPESLDIKE
INGNKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAV
ATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQ
LESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIFITYVIAGVTGFIGLDIIASLCNMI
MGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWDQGSTNEALYKLYSAAATHRHLYHQ
AFPTPKSESTEQSEKKKM
Sequence length 558
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
596
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Abnormality of the nervous system Likely pathogenic rs1064795212 RCV001814486
Accessory ectopic thyroid tissue Likely pathogenic rs1595625104 RCV001849513
ATL1-related spastic paraplegia, recessive Pathogenic rs1316385532 RCV005253870
Charcot-Marie-Tooth disease Pathogenic rs1555365597 RCV000789726
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Abnormal pyramidal sign Conflicting classifications of pathogenicity rs1060502971 RCV001526629
Acute myeloid leukemia Uncertain significance rs886050531 RCV005929299
Adrenocortical carcinoma, hereditary Benign rs35014209 RCV005887595
ATL1-related disorder Likely benign; Benign; Uncertain significance; Conflicting classifications of pathogenicity rs765171869, rs3759588, rs2504564196, rs186528086, rs951568761, rs147839037, rs76375909, rs146975855, rs139720661 RCV003930921
RCV003982898
RCV003403782
RCV003947533
RCV003397779
RCV003409489
RCV003940214
RCV003910175
RCV003910176
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alcoholic Neuropathy Associate 36359747
Alzheimer Disease Associate 22817815
Amyotrophic Lateral Sclerosis Associate 30778698
Aneurysm Associate 36717793
Ataxia Associate 30778698
Bulbar Palsy Progressive Associate 35925862
Carcinoma Hepatocellular Associate 36423520, 36893885, 39516467
Carcinoma Non Small Cell Lung Associate 37633973
Cerebral Palsy Associate 35076175
Cholesterol pneumonia Associate 33287888