Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51062
Gene name Gene Name - the full gene name approved by the HGNC.
Atlastin GTPase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ATL1
Synonyms (NCBI Gene) Gene synonyms aliases
AD-FSP, ATL-1, FSP1, GBP3, HSN1D, SPG3, SPG3A, atlastin1
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a GTPase and a Golgi body transmembrane protein. The encoded protein can form a homotetramer and has been shown to interact with spastin and with mitogen-activated protein kinase kinase kinase kinase 4. This protein may
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs28939094 A>G,T Uncertain-significance, likely-pathogenic Coding sequence variant, missense variant
rs119476046 C>T Pathogenic, pathogenic-likely-pathogenic Missense variant, coding sequence variant
rs119476047 C>A Pathogenic Missense variant, coding sequence variant
rs119476048 A>G Pathogenic Missense variant, coding sequence variant
rs119476049 G>A Likely-pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018361 hsa-miR-335-5p Microarray 18185580
MIRT021430 hsa-miR-9-5p Microarray 17612493
MIRT051409 hsa-let-7f-5p CLASH 23622248
MIRT805782 hsa-miR-1272 CLIP-seq
MIRT805783 hsa-miR-1322 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0000166 Function Nucleotide binding IEA
GO:0003924 Function GTPase activity IBA
GO:0003924 Function GTPase activity IEA
GO:0005515 Function Protein binding IPI 16815977, 19665976, 20200447, 23969831, 25751282, 32814053
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606439 11231 ENSG00000198513
Protein
UniProt ID Q8WXF7
Protein name Atlastin-1 (ATL-1) (EC 3.6.5.-) (Brain-specific GTP-binding protein) (GTP-binding protein 3) (GBP-3) (hGBP3) (Guanine nucleotide-binding protein 3) (Spastic paraplegia 3 protein A)
Protein function Atlastin-1 (ATL1) is a membrane-anchored GTPase that mediates the GTP-dependent fusion of endoplasmic reticulum (ER) membranes, maintaining the continuous ER network. It facilitates the formation of three-way junctions where ER tubules intersect
PDB 3Q5D , 3Q5E , 3QNU , 3QOF , 4IDN , 4IDO , 4IDP , 4IDQ , 6B9D , 6B9E , 6B9F , 6B9G , 6XJN , 7OL3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02263 GBP 43 314 Guanylate-binding protein, N-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed predominantly in the adult and fetal central nervous system. Measurable expression in all tissues examined, although expression in adult brain is at least 50-fold higher than in other tissues. Detected predominantly in pyrami
Sequence
MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDETALNRILLSE
AVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERET
TGIQIWSEIFLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQ
NVQEDDLQHLQLFTEYGRLAMEETFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRL
KVSGNQHEELQNVRKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKIL
IPWLLSPESLDIKE
INGNKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAV
ATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQ
LESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIFITYVIAGVTGFIGLDIIASLCNMI
MGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWDQGSTNEALYKLYSAAATHRHLYHQ
AFPTPKSESTEQSEKKKM
Sequence length 558
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Charcot-Marie-Tooth Disease Charcot-Marie-Tooth Disease rs1555365597 N/A
Hereditary motor and sensory neuropathy Neuropathy, hereditary sensory, type 1D rs387906941, rs1566733927, rs1555365597 N/A
Hereditary spastic paraplegia Hereditary spastic paraplegia 3A, Hereditary spastic paraplegia rs387906941, rs1064795212, rs1595600383, rs119476048, rs1555365854, rs1595625113, rs119476049, rs1555365595, rs1595625099, rs28939094, rs606231265, rs1555364247, rs119476050, rs786205487, rs1555365512
View all (16 more)
N/A
Spastic Paraplegia spastic paraplegia rs119476046 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alcoholic Neuropathy Associate 36359747
Alzheimer Disease Associate 22817815
Amyotrophic Lateral Sclerosis Associate 30778698
Aneurysm Associate 36717793
Ataxia Associate 30778698
Bulbar Palsy Progressive Associate 35925862
Carcinoma Hepatocellular Associate 36423520, 36893885, 39516467
Carcinoma Non Small Cell Lung Associate 37633973
Cerebral Palsy Associate 35076175
Cholesterol pneumonia Associate 33287888