Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	51042
Gene name Gene Name - the full gene name approved by the HGNC.	Zinc finger protein 593
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ZNF593
Synonyms (NCBI Gene) Gene synonyms aliases	ZT86
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p36.11

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT037146	hsa-miR-877-3p	CLASH	23622248

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	IMP	18287285
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0043021	Function	Ribonucleoprotein complex binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	9115366
GO:0046872	Function	Metal ion binding	IEA
GO:1903026	Process	Negative regulation of RNA polymerase II regulatory region sequence-specific DNA binding	IGI	9115366
GO:1990275	Function	Preribosome binding	IDA	32669547

MIM	HGNC	e!Ensembl
616698	30943	ENSG00000142684

Protein

UniProt ID

O00488

Protein name

Zinc finger protein 593 (Zinc finger protein T86)

Protein function

Involved in pre-60S ribosomal particles maturation by promoting the nuclear export of the 60S ribosome (PubMed:32669547). Negatively modulates the DNA binding activity of Oct-2 and therefore its transcriptional regulatory activity (PubMed:911536

PDB

1ZR9 , 6LSS , 6LU8 , 8FL2 , 8FL3 , 8FL4 , 8FL6 , 8FL7 , 8FL9 , 8FLA , 8FLB , 8FLC , 8FLD , 8FLE , 8FLF , 8IDT , 8IDY , 8IE3 , 8INE , 8INF , 8INK , 8IPD , 8IPX , 8IPY , 8IR3 , 8RL2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12171	zf-C2H2_jaz	60 → 86	Zinc-finger double-stranded RNA-binding	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Detected in spleen, prostate, testis, small intestine, colon and to a minor level in thymus and peripheral blood leukocytes. {ECO:0000269|PubMed:9115366}.

Sequence

MGRSRRTGAHRAHSLARQMKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGL
HRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVP
TEVSTEVPEMDTST

Sequence length

134

Interactions

View interactions

ZNF593 (zinc finger protein 593)