Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	51035
Gene name Gene Name - the full gene name approved by the HGNC.	UBX domain protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UBXN1
Synonyms (NCBI Gene) Gene synonyms aliases	2B28, SAKS1, UBXD10
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q12.3

Show/Hide all(29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003817	hsa-miR-373-3p	Microarray	15685193
MIRT020578	hsa-miR-155-5p	Proteomics	18668040
MIRT047839	hsa-miR-30c-5p	CLASH	23622248
MIRT046169	hsa-miR-27b-3p	CLASH	23622248
MIRT044114	hsa-miR-30e-3p	CLASH	23622248
MIRT040124	hsa-miR-615-3p	CLASH	23622248
MIRT1471943	hsa-miR-1207-3p	CLIP-seq
MIRT1471944	hsa-miR-124	CLIP-seq
MIRT1471945	hsa-miR-1302	CLIP-seq
MIRT1471946	hsa-miR-146a	CLIP-seq
MIRT1471947	hsa-miR-146b-5p	CLIP-seq
MIRT1471948	hsa-miR-298	CLIP-seq
MIRT1471949	hsa-miR-3126-5p	CLIP-seq
MIRT1471950	hsa-miR-3179	CLIP-seq
MIRT1471951	hsa-miR-3187-3p	CLIP-seq
MIRT1471952	hsa-miR-3622a-5p	CLIP-seq
MIRT1471953	hsa-miR-3936	CLIP-seq
MIRT1471954	hsa-miR-4298	CLIP-seq
MIRT1471955	hsa-miR-4435	CLIP-seq
MIRT1471956	hsa-miR-4701-5p	CLIP-seq
MIRT1471957	hsa-miR-4773	CLIP-seq
MIRT1471958	hsa-miR-506	CLIP-seq
MIRT1471959	hsa-miR-548s	CLIP-seq
MIRT1471960	hsa-miR-578	CLIP-seq
MIRT1471961	hsa-miR-588	CLIP-seq
MIRT1471962	hsa-miR-589	CLIP-seq
MIRT1471963	hsa-miR-922	CLIP-seq
MIRT1471950	hsa-miR-3179	CLIP-seq
MIRT1471953	hsa-miR-3936	CLIP-seq

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	18775313, 20351172, 25416956, 32296183, 32814053, 37776851
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	10942595
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	21135095
GO:0005829	Component	Cytosol	IDA	21135095
GO:0005829	Component	Cytosol	TAS
GO:0031397	Process	Negative regulation of protein ubiquitination	IBA
GO:0031397	Process	Negative regulation of protein ubiquitination	IDA	20351172
GO:0031593	Function	Polyubiquitin modification-dependent protein binding	IDA	15362974
GO:0031625	Function	Ubiquitin protein ligase binding	IDA	18775313
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	20351172
GO:0034098	Component	VCP-NPL4-UFD1 AAA ATPase complex	IDA	18775313
GO:0036435	Function	K48-linked polyubiquitin modification-dependent protein binding	IBA
GO:0036435	Function	K48-linked polyubiquitin modification-dependent protein binding	IDA	21135095
GO:0043130	Function	Ubiquitin binding	IDA	18775313
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	15362974
GO:0051117	Function	ATPase binding	IPI	15362974, 21135095
GO:0071796	Function	K6-linked polyubiquitin modification-dependent protein binding	IDA	20351172
GO:1903094	Process	Negative regulation of protein K48-linked deubiquitination	IBA
GO:1903094	Process	Negative regulation of protein K48-linked deubiquitination	IDA	21135095
GO:1904293	Process	Negative regulation of ERAD pathway	IMP	21135095
GO:1904855	Function	Proteasome regulatory particle binding	IDA	15362974

MIM	HGNC	e!Ensembl
616378	18402	ENSG00000162191

Protein

UniProt ID

Q04323

Protein name

UBX domain-containing protein 1 (SAPK substrate protein 1) (UBA/UBX 33.3 kDa protein)

Protein function

Ubiquitin-binding protein that plays a role in the modulation of innate immune response. Blocks both the RIG-I-like receptors (RLR) and NF-kappa-B pathways. Following viral infection, UBXN1 is induced and recruited to the RLR component MAVS. In

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00627	UBA	3 → 39	UBA/TS-N domain	Domain
PF00789	UBX	208 → 293	UBX domain	Domain

Sequence

MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHIL
GREPTSSEQGGLEGSGSAAGEGKPALSEEERQEQTKRMLELVAQKQREREEREEREALER
ERQRRRQGQELSAARQRLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYG
GSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVR
LYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLIVAKKCPS

Sequence length

297

Interactions

View interactions

	KEGG		Reactome
	Protein processing in endoplasmic reticulum		N-glycan trimming in the ER and Calnexin/Calreticulin cycle

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Insomnia	Insomnia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (1)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Vesicular Stomatitis	Associate	23545497

UBXN1 (UBX domain protein 1)