UBXN1 (UBX domain protein 1)

Gene

• Entrez ID: 51035
• Gene name: UBX domain protein 1
• Gene symbol: UBXN1
• Synonyms (NCBI Gene): 2B28, SAKS1, UBXD10
• Chromosome: 11
• Chromosome location: 11q12.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003817	hsa-miR-373-3p	Microarray	15685193
MIRT020578	hsa-miR-155-5p	Proteomics	18668040
MIRT047839	hsa-miR-30c-5p	CLASH	23622248
MIRT046169	hsa-miR-27b-3p	CLASH	23622248
MIRT044114	hsa-miR-30e-3p	CLASH	23622248
MIRT040124	hsa-miR-615-3p	CLASH	23622248
MIRT1471943	hsa-miR-1207-3p	CLIP-seq
MIRT1471944	hsa-miR-124	CLIP-seq
MIRT1471945	hsa-miR-1302	CLIP-seq
MIRT1471946	hsa-miR-146a	CLIP-seq
MIRT1471947	hsa-miR-146b-5p	CLIP-seq
MIRT1471948	hsa-miR-298	CLIP-seq
MIRT1471949	hsa-miR-3126-5p	CLIP-seq
MIRT1471950	hsa-miR-3179	CLIP-seq
MIRT1471951	hsa-miR-3187-3p	CLIP-seq
MIRT1471952	hsa-miR-3622a-5p	CLIP-seq
MIRT1471953	hsa-miR-3936	CLIP-seq
MIRT1471954	hsa-miR-4298	CLIP-seq
MIRT1471955	hsa-miR-4435	CLIP-seq
MIRT1471956	hsa-miR-4701-5p	CLIP-seq
MIRT1471957	hsa-miR-4773	CLIP-seq
MIRT1471958	hsa-miR-506	CLIP-seq
MIRT1471959	hsa-miR-548s	CLIP-seq
MIRT1471960	hsa-miR-578	CLIP-seq
MIRT1471961	hsa-miR-588	CLIP-seq
MIRT1471962	hsa-miR-589	CLIP-seq
MIRT1471963	hsa-miR-922	CLIP-seq
MIRT1471950	hsa-miR-3179	CLIP-seq
MIRT1471953	hsa-miR-3936	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	18775313, 20351172, 25416956, 32296183, 32814053, 37776851
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	10942595
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	21135095
GO:0005829	Component	Cytosol	IDA	21135095
GO:0005829	Component	Cytosol	TAS
GO:0031397	Process	Negative regulation of protein ubiquitination	IBA
GO:0031397	Process	Negative regulation of protein ubiquitination	IDA	20351172
GO:0031593	Function	Polyubiquitin modification-dependent protein binding	IDA	15362974
GO:0031625	Function	Ubiquitin protein ligase binding	IDA	18775313
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	20351172
GO:0034098	Component	VCP-NPL4-UFD1 AAA ATPase complex	IDA	18775313
GO:0036435	Function	K48-linked polyubiquitin modification-dependent protein binding	IBA
GO:0036435	Function	K48-linked polyubiquitin modification-dependent protein binding	IDA	21135095
GO:0043130	Function	Ubiquitin binding	IDA	18775313
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	15362974
GO:0051117	Function	ATPase binding	IPI	15362974, 21135095
GO:0071796	Function	K6-linked polyubiquitin modification-dependent protein binding	IDA	20351172
GO:1903094	Process	Negative regulation of protein K48-linked deubiquitination	IBA
GO:1903094	Process	Negative regulation of protein K48-linked deubiquitination	IDA	21135095
GO:1904293	Process	Negative regulation of ERAD pathway	IMP	21135095
GO:1904855	Function	Proteasome regulatory particle binding	IDA	15362974

Other IDs

• MIM: 616378
• HGNC: 18402
• e!Ensembl: ENSG00000162191

Protein

• UniProt ID: Q04323
• Protein name: UBX domain-containing protein 1 (SAPK substrate protein 1) (UBA/UBX 33.3 kDa protein)
• Protein function: Ubiquitin-binding protein that plays a role in the modulation of innate immune response. Blocks both the RIG-I-like receptors (RLR) and NF-kappa-B pathways. Following viral infection, UBXN1 is induced and recruited to the RLR component MAVS. In
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00627	UBA	3 → 39	UBA/TS-N domain	Domain
  PF00789	UBX	208 → 293	UBX domain	Domain

• Sequence:

  MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHIL
  GREPTSSEQGGLEGSGSAAGEGKPALSEEERQEQTKRMLELVAQKQREREEREEREALER
  ERQRRRQGQELSAARQRLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYG
  GSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVR
  LYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLIVAKKCPS

• Sequence length: 297

Pathways

KEGG:

Protein processing in endoplasmic reticulum

Reactome:

N-glycan trimming in the ER and Calnexin/Calreticulin cycle

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Colon adenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Vesicular Stomatitis	Associate	23545497	★☆☆☆☆ Found in Text Mining only