Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	51029
Gene name Gene Name - the full gene name approved by the HGNC.	Desumoylating isopeptidase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DESI2
Synonyms (NCBI Gene) Gene synonyms aliases	C1orf121, CGI-146, DESI, DESI1, DeSI-2, FAM152A, PNAS-4, PPPDE1
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q44

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT041187	hsa-miR-497-5p	CLASH	23622248

Show/Hide all(14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	28483520
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0005515	Function	Protein binding	IPI	28483520, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008474	Function	Palmitoyl-(protein) hydrolase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0052816	Function	Long-chain fatty acyl-CoA hydrolase activity	IDA	35427157
GO:0061578	Function	K63-linked deubiquitinase activity	IMP	28483520
GO:0098734	Process	Macromolecule depalmitoylation	IEA
GO:0101005	Function	Deubiquitinase activity	IBA
GO:1990380	Function	K48-linked deubiquitinase activity	IMP	28483520

MIM	HGNC	e!Ensembl
614638	24264	ENSG00000121644

Protein

UniProt ID

Q9BSY9

Protein name

Deubiquitinase DESI2 (EC 3.4.19.12) (Desumoylating isopeptidase 2) (DeSI-2) (PPPDE peptidase domain-containing protein 1) (Palmitoyl protein thioesterase DESI2) (EC 3.1.2.22) (Protein FAM152A) (S-depalmitoylase DESI2)

Protein function

Has deubiquitinating activity towards 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. Deubiquitinates 'Lys-48'-linked polyubiquitination of RPS7 leading to its stabilization (PubMed:28483520). Exhibits palmitoyl protein thioesterase (S-depal

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05903	Peptidase_C97	5 → 149	PPPDE putative peptidase domain	Domain

Sequence

MGANQLVVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNA
SELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILC
GKEIPRWINRLAYFSSCIPFLQSCLPKEWLTPAALQSSVSQELQDELEEAEDAAASASVA
STAAGSRPGRHTKL

Sequence length

194

Interactions

View interactions

DESI2 (desumoylating isopeptidase 2)