Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	51024
Gene name Gene Name - the full gene name approved by the HGNC.	Fission, mitochondrial 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FIS1
Synonyms (NCBI Gene) Gene synonyms aliases	CGI-135, TTC11
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q22.1
Summary Summary of gene provided in NCBI Entrez Gene.	The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM, Mar 2008]

Show/Hide all(81)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006714	hsa-miR-484	ChIP-seq, Immunoblot, LacZ reporter assay, qRT-PCR	22510686
MIRT041016	hsa-miR-505-3p	CLASH	23622248
MIRT736756	hsa-miR-483-5p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR, In situ hybridization	25843291
MIRT996950	hsa-miR-1252	CLIP-seq
MIRT996951	hsa-miR-1266	CLIP-seq
MIRT996952	hsa-miR-216a	CLIP-seq
MIRT996953	hsa-miR-330-3p	CLIP-seq
MIRT996954	hsa-miR-3664-3p	CLIP-seq
MIRT996955	hsa-miR-3675-5p	CLIP-seq
MIRT996956	hsa-miR-4283	CLIP-seq
MIRT996957	hsa-miR-4489	CLIP-seq
MIRT996958	hsa-miR-4518	CLIP-seq
MIRT996959	hsa-miR-4656	CLIP-seq
MIRT1556389	hsa-miR-2277-3p	CLIP-seq
MIRT1556390	hsa-miR-2392	CLIP-seq
MIRT1556391	hsa-miR-3605-3p	CLIP-seq
MIRT1556392	hsa-miR-3605-5p	CLIP-seq
MIRT1556393	hsa-miR-3690	CLIP-seq
MIRT1556394	hsa-miR-4254	CLIP-seq
MIRT1556395	hsa-miR-4290	CLIP-seq
MIRT1556396	hsa-miR-4520a-3p	CLIP-seq
MIRT1556397	hsa-miR-4667-3p	CLIP-seq
MIRT1995612	hsa-miR-1185	CLIP-seq
MIRT1995613	hsa-miR-1207-5p	CLIP-seq
MIRT996950	hsa-miR-1252	CLIP-seq
MIRT996951	hsa-miR-1266	CLIP-seq
MIRT1995614	hsa-miR-1909	CLIP-seq
MIRT996952	hsa-miR-216a	CLIP-seq
MIRT1556389	hsa-miR-2277-3p	CLIP-seq
MIRT1556390	hsa-miR-2392	CLIP-seq
MIRT1995615	hsa-miR-3153	CLIP-seq
MIRT1995616	hsa-miR-3175	CLIP-seq
MIRT996953	hsa-miR-330-3p	CLIP-seq
MIRT1556392	hsa-miR-3605-5p	CLIP-seq
MIRT996954	hsa-miR-3664-3p	CLIP-seq
MIRT996955	hsa-miR-3675-5p	CLIP-seq
MIRT1995617	hsa-miR-3679-5p	CLIP-seq
MIRT1556393	hsa-miR-3690	CLIP-seq
MIRT1995618	hsa-miR-3976	CLIP-seq
MIRT1556394	hsa-miR-4254	CLIP-seq
MIRT996956	hsa-miR-4283	CLIP-seq
MIRT1556395	hsa-miR-4290	CLIP-seq
MIRT1995619	hsa-miR-4468	CLIP-seq
MIRT996957	hsa-miR-4489	CLIP-seq
MIRT996958	hsa-miR-4518	CLIP-seq
MIRT1556396	hsa-miR-4520a-3p	CLIP-seq
MIRT996959	hsa-miR-4656	CLIP-seq
MIRT1556397	hsa-miR-4667-3p	CLIP-seq
MIRT1995620	hsa-miR-4699-3p	CLIP-seq
MIRT1995621	hsa-miR-4716-3p	CLIP-seq
MIRT1995622	hsa-miR-4723-5p	CLIP-seq
MIRT1995623	hsa-miR-4733-5p	CLIP-seq
MIRT1995624	hsa-miR-4763-3p	CLIP-seq
MIRT1995625	hsa-miR-4773	CLIP-seq
MIRT1995626	hsa-miR-486-3p	CLIP-seq
MIRT1995627	hsa-miR-939	CLIP-seq
MIRT1995612	hsa-miR-1185	CLIP-seq
MIRT1995613	hsa-miR-1207-5p	CLIP-seq
MIRT1995614	hsa-miR-1909	CLIP-seq
MIRT1556389	hsa-miR-2277-3p	CLIP-seq
MIRT1995615	hsa-miR-3153	CLIP-seq
MIRT1995616	hsa-miR-3175	CLIP-seq
MIRT1995617	hsa-miR-3679-5p	CLIP-seq
MIRT1995618	hsa-miR-3976	CLIP-seq
MIRT1995621	hsa-miR-4716-3p	CLIP-seq
MIRT1995622	hsa-miR-4723-5p	CLIP-seq
MIRT1995624	hsa-miR-4763-3p	CLIP-seq
MIRT1995625	hsa-miR-4773	CLIP-seq
MIRT1995626	hsa-miR-486-3p	CLIP-seq
MIRT1995613	hsa-miR-1207-5p	CLIP-seq
MIRT1995614	hsa-miR-1909	CLIP-seq
MIRT1556389	hsa-miR-2277-3p	CLIP-seq
MIRT1556390	hsa-miR-2392	CLIP-seq
MIRT1995615	hsa-miR-3153	CLIP-seq
MIRT1995616	hsa-miR-3175	CLIP-seq
MIRT1556392	hsa-miR-3605-5p	CLIP-seq
MIRT1995621	hsa-miR-4716-3p	CLIP-seq
MIRT1995622	hsa-miR-4723-5p	CLIP-seq
MIRT1995624	hsa-miR-4763-3p	CLIP-seq
MIRT1995625	hsa-miR-4773	CLIP-seq
MIRT1995626	hsa-miR-486-3p	CLIP-seq

Show/Hide all(52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000266	Process	Mitochondrial fission	IBA
GO:0000266	Process	Mitochondrial fission	IDA	16118244, 17545159, 18845145, 23283981
GO:0000266	Process	Mitochondrial fission	IEA
GO:0000266	Process	Mitochondrial fission	IMP	18353969, 19864424
GO:0005515	Function	Protein binding	IPI	12861026, 16874301, 17408615, 18782765, 20826455, 21149567, 21183955, 21699783, 21701560, 25416956, 29464060, 32296183
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	17408615, 17545159, 18782765, 19864424, 20451243, 21183955
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IBA
GO:0005741	Component	Mitochondrial outer membrane	IDA	14996942
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	NAS	18845145
GO:0005777	Component	Peroxisome	IDA	18782765, 20451243, 23921378
GO:0005777	Component	Peroxisome	IEA
GO:0005777	Component	Peroxisome	ISS	14561759
GO:0005778	Component	Peroxisomal membrane	IBA
GO:0005778	Component	Peroxisomal membrane	IDA	16107562, 17408615
GO:0005778	Component	Peroxisomal membrane	IEA
GO:0005778	Component	Peroxisomal membrane	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006626	Process	Protein targeting to mitochondrion	IMP	18845145
GO:0006915	Process	Apoptotic process	IEA
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007005	Process	Mitochondrion organization	IMP	21149567
GO:0007005	Process	Mitochondrion organization	IMP	18845145, 21149567
GO:0008289	Function	Lipid binding	EXP	14623186
GO:0008289	Function	Lipid binding	IBA
GO:0014850	Process	Response to muscle activity	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016559	Process	Peroxisome fission	IBA
GO:0016559	Process	Peroxisome fission	IDA	16107562, 17408615
GO:0016559	Process	Peroxisome fission	IMP	20826455
GO:0031667	Process	Response to nutrient levels	IEA
GO:0032991	Component	Protein-containing complex	IDA	17408615, 18353969, 20826455
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0042802	Function	Identical protein binding	IPI	18353969, 18845145
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043653	Process	Mitochondrial fragmentation involved in apoptotic process	IEA
GO:0060090	Function	Molecular adaptor activity	EXP	14623186
GO:0060090	Function	Molecular adaptor activity	IBA
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071396	Process	Cellular response to lipid	IEA
GO:0090141	Process	Positive regulation of mitochondrial fission	IEA
GO:0097237	Process	Cellular response to toxic substance	IEA
GO:1901653	Process	Cellular response to peptide	IEA
GO:1902617	Process	Response to fluoride	IEA
GO:1903579	Process	Negative regulation of ATP metabolic process	IMP	32521232
GO:1905395	Process	Response to flavonoid	IEA
GO:1990910	Process	Response to hypobaric hypoxia	IEA
GO:2000192	Process	Negative regulation of fatty acid transport	IMP	32521232
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IMP	21183955

MIM	HGNC	e!Ensembl
609003	21689	ENSG00000214253

Protein

UniProt ID

Q9Y3D6

Protein name

Mitochondrial fission 1 protein (FIS1 homolog) (hFis1) (Tetratricopeptide repeat protein 11) (TPR repeat protein 11)

Protein function

Involved in the fragmentation of the mitochondrial network and its perinuclear clustering (PubMed:12783892, PubMed:12861026, PubMed:14996942, PubMed:23283981). Plays a minor role in the recruitment and association of the fission mediator dynamin

PDB

1NZN , 1PC2 , 7YA9 , 7YKA , 8U1Z , 8XWX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14852	Fis1_TPR_N	33 → 65	Fis1 N-terminal tetratricopeptide repeat	Domain
PF14853	Fis1_TPR_C	71 → 123	Fis1 C-terminal tetratricopeptide repeat	Domain

Sequence

MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEE
LLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKK
DGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS

Sequence length

152

Interactions

View interactions

	KEGG		Reactome
	Mitophagy - animal		Class I peroxisomal membrane protein import

FIS1 (fission, mitochondrial 1)