FIS1 (fission, mitochondrial 1)

Gene

• Entrez ID: 51024
• Gene name: Fission, mitochondrial 1
• Gene symbol: FIS1
• Synonyms (NCBI Gene): CGI-135, TTC11
• Chromosome: 7
• Chromosome location: 7q22.1
• Summary: The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM, Mar 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006714	hsa-miR-484	ChIP-seq, Immunoblot, LacZ reporter assay, qRT-PCR	22510686
MIRT041016	hsa-miR-505-3p	CLASH	23622248
MIRT736756	hsa-miR-483-5p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR, In situ hybridization	25843291
MIRT996950	hsa-miR-1252	CLIP-seq
MIRT996951	hsa-miR-1266	CLIP-seq
MIRT996952	hsa-miR-216a	CLIP-seq
MIRT996953	hsa-miR-330-3p	CLIP-seq
MIRT996954	hsa-miR-3664-3p	CLIP-seq
MIRT996955	hsa-miR-3675-5p	CLIP-seq
MIRT996956	hsa-miR-4283	CLIP-seq
MIRT996957	hsa-miR-4489	CLIP-seq
MIRT996958	hsa-miR-4518	CLIP-seq
MIRT996959	hsa-miR-4656	CLIP-seq
MIRT1556389	hsa-miR-2277-3p	CLIP-seq
MIRT1556390	hsa-miR-2392	CLIP-seq
MIRT1556391	hsa-miR-3605-3p	CLIP-seq
MIRT1556392	hsa-miR-3605-5p	CLIP-seq
MIRT1556393	hsa-miR-3690	CLIP-seq
MIRT1556394	hsa-miR-4254	CLIP-seq
MIRT1556395	hsa-miR-4290	CLIP-seq
MIRT1556396	hsa-miR-4520a-3p	CLIP-seq
MIRT1556397	hsa-miR-4667-3p	CLIP-seq
MIRT1995612	hsa-miR-1185	CLIP-seq
MIRT1995613	hsa-miR-1207-5p	CLIP-seq
MIRT996950	hsa-miR-1252	CLIP-seq
MIRT996951	hsa-miR-1266	CLIP-seq
MIRT1995614	hsa-miR-1909	CLIP-seq
MIRT996952	hsa-miR-216a	CLIP-seq
MIRT1556389	hsa-miR-2277-3p	CLIP-seq
MIRT1556390	hsa-miR-2392	CLIP-seq
MIRT1995615	hsa-miR-3153	CLIP-seq
MIRT1995616	hsa-miR-3175	CLIP-seq
MIRT996953	hsa-miR-330-3p	CLIP-seq
MIRT1556392	hsa-miR-3605-5p	CLIP-seq
MIRT996954	hsa-miR-3664-3p	CLIP-seq
MIRT996955	hsa-miR-3675-5p	CLIP-seq
MIRT1995617	hsa-miR-3679-5p	CLIP-seq
MIRT1556393	hsa-miR-3690	CLIP-seq
MIRT1995618	hsa-miR-3976	CLIP-seq
MIRT1556394	hsa-miR-4254	CLIP-seq
MIRT996956	hsa-miR-4283	CLIP-seq
MIRT1556395	hsa-miR-4290	CLIP-seq
MIRT1995619	hsa-miR-4468	CLIP-seq
MIRT996957	hsa-miR-4489	CLIP-seq
MIRT996958	hsa-miR-4518	CLIP-seq
MIRT1556396	hsa-miR-4520a-3p	CLIP-seq
MIRT996959	hsa-miR-4656	CLIP-seq
MIRT1556397	hsa-miR-4667-3p	CLIP-seq
MIRT1995620	hsa-miR-4699-3p	CLIP-seq
MIRT1995621	hsa-miR-4716-3p	CLIP-seq
MIRT1995622	hsa-miR-4723-5p	CLIP-seq
MIRT1995623	hsa-miR-4733-5p	CLIP-seq
MIRT1995624	hsa-miR-4763-3p	CLIP-seq
MIRT1995625	hsa-miR-4773	CLIP-seq
MIRT1995626	hsa-miR-486-3p	CLIP-seq
MIRT1995627	hsa-miR-939	CLIP-seq
MIRT1995612	hsa-miR-1185	CLIP-seq
MIRT1995613	hsa-miR-1207-5p	CLIP-seq
MIRT1995614	hsa-miR-1909	CLIP-seq
MIRT1556389	hsa-miR-2277-3p	CLIP-seq
MIRT1995615	hsa-miR-3153	CLIP-seq
MIRT1995616	hsa-miR-3175	CLIP-seq
MIRT1995617	hsa-miR-3679-5p	CLIP-seq
MIRT1995618	hsa-miR-3976	CLIP-seq
MIRT1995621	hsa-miR-4716-3p	CLIP-seq
MIRT1995622	hsa-miR-4723-5p	CLIP-seq
MIRT1995624	hsa-miR-4763-3p	CLIP-seq
MIRT1995625	hsa-miR-4773	CLIP-seq
MIRT1995626	hsa-miR-486-3p	CLIP-seq
MIRT1995613	hsa-miR-1207-5p	CLIP-seq
MIRT1995614	hsa-miR-1909	CLIP-seq
MIRT1556389	hsa-miR-2277-3p	CLIP-seq
MIRT1556390	hsa-miR-2392	CLIP-seq
MIRT1995615	hsa-miR-3153	CLIP-seq
MIRT1995616	hsa-miR-3175	CLIP-seq
MIRT1556392	hsa-miR-3605-5p	CLIP-seq
MIRT1995621	hsa-miR-4716-3p	CLIP-seq
MIRT1995622	hsa-miR-4723-5p	CLIP-seq
MIRT1995624	hsa-miR-4763-3p	CLIP-seq
MIRT1995625	hsa-miR-4773	CLIP-seq
MIRT1995626	hsa-miR-486-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000266	Process	Mitochondrial fission	IBA	21873635
GO:0000266	Process	Mitochondrial fission	IDA	16118244, 18845145
GO:0000266	Process	Mitochondrial fission	IMP	19864424
GO:0000422	Process	Autophagy of mitochondrion	IBA	21873635
GO:0000422	Process	Autophagy of mitochondrion	IDA	18515060
GO:0001836	Process	Release of cytochrome c from mitochondria	IMP	19864424
GO:0005515	Function	Protein binding	IPI	12861026, 16874301, 17408615, 18782765, 20826455, 21149567, 21183955, 21699783, 21701560, 25416956, 29464060, 32296183
GO:0005739	Component	Mitochondrion	IDA	17408615, 17545159, 18782765, 19864424, 20451243, 21183955
GO:0005777	Component	Peroxisome	IDA	18782765, 20451243, 23921378
GO:0005777	Component	Peroxisome	ISS	14561759
GO:0005779	Component	Integral component of peroxisomal membrane	IBA	21873635
GO:0005779	Component	Integral component of peroxisomal membrane	IDA	16107562, 17408615
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0006626	Process	Protein targeting to mitochondrion	IMP	18845145
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IMP	21183955
GO:0008053	Process	Mitochondrial fusion	IMP	23921378
GO:0010821	Process	Regulation of mitochondrion organization	IMP	18353969, 21149567
GO:0016020	Component	Membrane	HDA	19946888
GO:0016559	Process	Peroxisome fission	IBA	21873635
GO:0016559	Process	Peroxisome fission	IDA	16107562, 17408615
GO:0016559	Process	Peroxisome fission	IMP	20826455
GO:0031307	Component	Integral component of mitochondrial outer membrane	IBA	21873635
GO:0031307	Component	Integral component of mitochondrial outer membrane	IDA	14996942
GO:0031307	Component	Integral component of mitochondrial outer membrane	NAS	18845145
GO:0032471	Process	Negative regulation of endoplasmic reticulum calcium ion concentration	IMP	21183955
GO:0032991	Component	Protein-containing complex	IDA	17408615, 18353969, 20826455
GO:0035584	Process	Calcium-mediated signaling using intracellular calcium source	IMP	21183955
GO:0042802	Function	Identical protein binding	IPI	18353969, 18845145
GO:0043280	Process	Positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	21183955
GO:0043653	Process	Mitochondrial fragmentation involved in apoptotic process	IBA	21873635
GO:0043653	Process	Mitochondrial fragmentation involved in apoptotic process	IDA	16118244, 17545159
GO:0043653	Process	Mitochondrial fragmentation involved in apoptotic process	IMP	18353969, 19864424
GO:0051561	Process	Positive regulation of mitochondrial calcium ion concentration	IMP	21183955
GO:0070584	Process	Mitochondrion morphogenesis	IMP	18845145, 21149567
GO:0090141	Process	Positive regulation of mitochondrial fission	IDA	23283981
GO:0090314	Process	Positive regulation of protein targeting to membrane	IDA	23283981
GO:1903579	Process	Negative regulation of ATP metabolic process	IMP	32521232
GO:2000192	Process	Negative regulation of fatty acid transport	IMP	32521232
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IMP	21183955

Other IDs

• MIM: 609003
• HGNC: 21689
• e!Ensembl: ENSG00000214253

Protein

• UniProt ID: Q9Y3D6
• Protein name: Mitochondrial fission 1 protein (FIS1 homolog) (hFis1) (Tetratricopeptide repeat protein 11) (TPR repeat protein 11)
• Protein function: Involved in the fragmentation of the mitochondrial network and its perinuclear clustering (PubMed:12783892, PubMed:12861026, PubMed:14996942, PubMed:23283981). Plays a minor role in the recruitment and association of the fission mediator dynamin
• PDB: 1NZN, 1PC2, 7YA9, 7YKA, 8U1Z, 8XWX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14852	Fis1_TPR_N	33 → 65	Fis1 N-terminal tetratricopeptide repeat	Domain
  PF14853	Fis1_TPR_C	71 → 123	Fis1 C-terminal tetratricopeptide repeat	Domain

• Sequence:

  MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEE
  LLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKK
  DGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS

• Sequence length: 152

Pathways

KEGG:

Mitophagy - animal

Reactome:

Class I peroxisomal membrane protein import

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Neuronal ceroid lipofuscinosis	Ceroid lipofuscinosis, neuronal 1, infantile	rs118203975, rs118203976, rs118203977, rs267607235, rs140948465, rs1740291234, rs386833969, rs104894385, rs104894386, rs121908292, rs267606738, rs1555274312, rs119455953, rs119455954, rs119455955, rs56144125, rs119455956, rs28940573, rs119455957, rs119455958, rs104894064, rs28940569, rs104894060, rs137852883, rs1555468634, rs121434286, rs267606737, rs104894483, rs397515352, rs774543080, rs121908080, rs786205067, rs137852695, rs137852696, rs137852697, rs137852698, rs137852699, rs137852700, rs137852701, rs137852702, rs63749877, rs121912789, rs121912790, rs786205105, rs154774634, rs587776892, rs387907246, rs386833624, rs386833626, rs386833625, rs386833627, rs386833628, rs386833629, rs386833630, rs386833632, rs386833633, rs386833634, rs386833635, rs386833636, rs386833637, rs386833638, rs386833641, rs386833642, rs386833643, rs386833644, rs386833645, rs386833646, rs386833647, rs386833648, rs386833649, rs386833650, rs386833651, rs386833652, rs386833653, rs148412181, rs386833654, rs386833655, rs386833656, rs386833657, rs386833658, rs386833659, rs386833660, rs386833661, rs386833663, rs386833664, rs386833665, rs386833666, rs386833667, rs386833668, rs386833669, rs386833671, rs386833694, rs386833695, rs386833696, rs386833697, rs386833698, rs386833699, rs386833700, rs386833701, rs386833702, rs386833703, rs386833704, rs386833705, rs386833706, rs386833707, rs386833708, rs386833709, rs386833710, rs386833712, rs386833713, rs386833714, rs386833715, rs386833717, rs386833720, rs386833721, rs386833722, rs386833724, rs386833725, rs386833726, rs386833728, rs386833729, rs386833730, rs386833731, rs386833732, rs386833735, rs386833736, rs386833737, rs386833739, rs386833740, rs386833741, rs386833742, rs386833743, rs386833744, rs386833963, rs386833964, rs386833965, rs386833966, rs386833967, rs386833970, rs386833971, rs386833972, rs386833973, rs386833974, rs386833975, rs386833978, rs386833979, rs386833980, rs386833981, rs386833982, rs386833983, rs386834123, rs386834124, rs386834125, rs386834126, rs386834128, rs386834130, rs386834132, rs386834133, rs386834135, rs34238807, rs386834138, rs386834139, rs397514731, rs397514732, rs753084727, rs587778809, rs154774640, rs154774639, rs121908197, rs121908198, rs121908199, rs121908200, rs121908201, rs121908203, rs121908202, rs121908195, rs121908204, rs121908205, rs121908209, rs121908207, rs104895127, rs63750411, rs587779397, rs587780315, rs724159970, rs727502800, rs727502801, rs724159971, rs746645358, rs786204553, rs786204753, rs778232650, rs786204644, rs794727955, rs794729218, rs796052925, rs796052923, rs796052927, rs558274487, rs796052752, rs144495588, rs1554901472, rs750428882, rs796053439, rs763162812, rs756564767, rs202189057, rs759080581, rs746085696, rs546989392, rs143781303, rs796052356, rs796052351, rs796052335, rs797045136, rs797045137, rs765097897, rs864309505, rs869025274, rs869312751, rs1085307087, rs878853322, rs878853325, rs878853929, rs878855053, rs878855331, rs553522118, rs748710466, rs886041568, rs886041487, rs886041546, rs1057516575, rs1057516889, rs1057517401, rs1057516447, rs1057517049, rs1057517192, rs1057517368, rs1057517112, rs747204624, rs1057516867, rs1057516582, rs756267448, rs1057516579, rs1057516511, rs1057516264, rs1057516319, rs113019349, rs1057517313, rs1057516945, rs752164603, rs1057516366, rs1057516667, rs1057516814, rs780198002, rs1057517134, rs1057516390, rs764495616, rs750935331, rs1057516677, rs1057516267, rs771788391, rs1057517350, rs1057516335, rs1057517287, rs1057517215, rs1057516343, rs777625354, rs764051026, rs559155109, rs1064796787, rs139842473, rs1064794233, rs181995380, rs1064795153, rs752612332, rs1131691676, rs1131691539, rs1555438255, rs1555058286, rs1555274005, rs1555468632, rs200348035, rs1265044710, rs1439582451, rs751696703, rs761621368, rs143730802, rs1554901580, rs1554902052, rs1553950197, rs200319160, rs143657539, rs1554901523, rs1555274338, rs1555273604, rs1555273881, rs1216139602, rs762226836, rs1553167863, rs1553166135, rs1553166147, rs1553167430, rs1349528345, rs1553166499, rs1553166337, rs1553167415, rs1553167474, rs1553167479, rs1554451504, rs746397087, rs1554449028, rs759830733, rs1554449124, rs554042394, rs1554451484, rs1554448874, rs1554448924, rs1554449047, rs1554449136, rs1554901463, rs1184563885, rs1554902043, rs763961289, rs1407106889, rs1554901576, rs1554901731, rs1424116749, rs1554901784, rs1554902216, rs779615685, rs1554902085, rs764790770, rs1555274343, rs1555274369, rs1555273567, rs1555274365, rs1555273609, rs1555274344, rs1555274373, rs1555274387, rs1451777867, rs762902907, rs756522171, rs1555438212, rs1555438443, rs1555468374, rs1555469452, rs1555467473, rs1418997146, rs1555273882, rs1478660606, rs1555273992, rs1555274014, rs1555274337, rs142456044, rs1555469159, rs758921701, rs1555469089, rs1555469477, rs1554901898, rs1554902217, rs1564855860, rs1564854729, rs1460276679, rs1560776422, rs556661896, rs868732642, rs1564855725, rs1566219136, rs1381427322, rs1557714302, rs1593914689, rs1302326945, rs1570470281, rs1570476221, rs775699005, rs1578912362, rs750162094, rs759664259, rs1589947644, rs1012449574, rs1570467252, rs778875017, rs1578794927, rs1578912759, rs1314967038, rs1465284719, rs1595816465, rs1595816474, rs1596563048, rs1565311875, rs2046113301, rs1578889355, rs776253867, rs1649597261, rs1649901192, rs749315686, rs1801297484, rs764256845, rs1242337070, rs2034349431, rs1380684360, rs1648444864, rs1739594685, rs1736369601, rs1739482158, rs1471253353, rs2046243804, rs1845791308, rs1397197980, rs2046158549	21224254

Associations from Text Mining
Disease Name	Relationship Type	References
Amyotrophic Lateral Sclerosis	Associate	31843624
Antiphospholipid Syndrome	Associate	22529290
Autism Spectrum Disorder	Associate	23333625
Barrett Esophagus	Associate	30404157
Bipolar Disorder	Associate	28463235
Charcot Marie Tooth Disease	Associate	21890626
Fatigue	Associate	23047795, 24786901
Glomerulonephritis Membranous	Associate	30566949
Huntington Disease	Associate	21257639
Inflammation	Inhibit	31843624
Leukemia	Associate	29979990
Leukemia Myeloid Acute	Associate	24416201, 29979990
Mitochondrial Diseases	Associate	30656603, 38103512
Muscular Dystrophy Congenital Megaconial Type	Associate	34518586
Nephrotic Syndrome	Stimulate	30566949
Nerve Degeneration	Associate	21257639
Prostatic Neoplasms	Associate	23047795
Sjogren's Syndrome	Associate	35359935
Sleep Deprivation	Associate	37962528
Tongue Neoplasms	Associate	30656603