Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	51024
Gene name	Fission, mitochondrial 1
Gene symbol	FIS1
Synonyms (NCBI Gene)	CGI-135TTC11
Chromosome	7
Chromosome location	7q22.1
Summary	The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM, Mar 2008]

Show/Hide all (81)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006714	hsa-miR-484	ChIP-seqImmunoblotLacZ reporter assayqRT-PCR	22510686
MIRT041016	hsa-miR-505-3p	CLASH	23622248
MIRT736756	hsa-miR-483-5p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)qRT-PCRIn situ hybridization	25843291
MIRT996950	hsa-miR-1252	CLIP-seq
MIRT996951	hsa-miR-1266	CLIP-seq
MIRT996952	hsa-miR-216a	CLIP-seq
MIRT996953	hsa-miR-330-3p	CLIP-seq
MIRT996954	hsa-miR-3664-3p	CLIP-seq
MIRT996955	hsa-miR-3675-5p	CLIP-seq
MIRT996956	hsa-miR-4283	CLIP-seq
MIRT996957	hsa-miR-4489	CLIP-seq
MIRT996958	hsa-miR-4518	CLIP-seq
MIRT996959	hsa-miR-4656	CLIP-seq
MIRT1556389	hsa-miR-2277-3p	CLIP-seq
MIRT1556390	hsa-miR-2392	CLIP-seq
MIRT1556391	hsa-miR-3605-3p	CLIP-seq
MIRT1556392	hsa-miR-3605-5p	CLIP-seq
MIRT1556393	hsa-miR-3690	CLIP-seq
MIRT1556394	hsa-miR-4254	CLIP-seq
MIRT1556395	hsa-miR-4290	CLIP-seq
MIRT1556396	hsa-miR-4520a-3p	CLIP-seq
MIRT1556397	hsa-miR-4667-3p	CLIP-seq
MIRT1995612	hsa-miR-1185	CLIP-seq
MIRT1995613	hsa-miR-1207-5p	CLIP-seq
MIRT996950	hsa-miR-1252	CLIP-seq
MIRT996951	hsa-miR-1266	CLIP-seq
MIRT1995614	hsa-miR-1909	CLIP-seq
MIRT996952	hsa-miR-216a	CLIP-seq
MIRT1556389	hsa-miR-2277-3p	CLIP-seq
MIRT1556390	hsa-miR-2392	CLIP-seq
MIRT1995615	hsa-miR-3153	CLIP-seq
MIRT1995616	hsa-miR-3175	CLIP-seq
MIRT996953	hsa-miR-330-3p	CLIP-seq
MIRT1556392	hsa-miR-3605-5p	CLIP-seq
MIRT996954	hsa-miR-3664-3p	CLIP-seq
MIRT996955	hsa-miR-3675-5p	CLIP-seq
MIRT1995617	hsa-miR-3679-5p	CLIP-seq
MIRT1556393	hsa-miR-3690	CLIP-seq
MIRT1995618	hsa-miR-3976	CLIP-seq
MIRT1556394	hsa-miR-4254	CLIP-seq
MIRT996956	hsa-miR-4283	CLIP-seq
MIRT1556395	hsa-miR-4290	CLIP-seq
MIRT1995619	hsa-miR-4468	CLIP-seq
MIRT996957	hsa-miR-4489	CLIP-seq
MIRT996958	hsa-miR-4518	CLIP-seq
MIRT1556396	hsa-miR-4520a-3p	CLIP-seq
MIRT996959	hsa-miR-4656	CLIP-seq
MIRT1556397	hsa-miR-4667-3p	CLIP-seq
MIRT1995620	hsa-miR-4699-3p	CLIP-seq
MIRT1995621	hsa-miR-4716-3p	CLIP-seq
MIRT1995622	hsa-miR-4723-5p	CLIP-seq
MIRT1995623	hsa-miR-4733-5p	CLIP-seq
MIRT1995624	hsa-miR-4763-3p	CLIP-seq
MIRT1995625	hsa-miR-4773	CLIP-seq
MIRT1995626	hsa-miR-486-3p	CLIP-seq
MIRT1995627	hsa-miR-939	CLIP-seq
MIRT1995612	hsa-miR-1185	CLIP-seq
MIRT1995613	hsa-miR-1207-5p	CLIP-seq
MIRT1995614	hsa-miR-1909	CLIP-seq
MIRT1556389	hsa-miR-2277-3p	CLIP-seq
MIRT1995615	hsa-miR-3153	CLIP-seq
MIRT1995616	hsa-miR-3175	CLIP-seq
MIRT1995617	hsa-miR-3679-5p	CLIP-seq
MIRT1995618	hsa-miR-3976	CLIP-seq
MIRT1995621	hsa-miR-4716-3p	CLIP-seq
MIRT1995622	hsa-miR-4723-5p	CLIP-seq
MIRT1995624	hsa-miR-4763-3p	CLIP-seq
MIRT1995625	hsa-miR-4773	CLIP-seq
MIRT1995626	hsa-miR-486-3p	CLIP-seq
MIRT1995613	hsa-miR-1207-5p	CLIP-seq
MIRT1995614	hsa-miR-1909	CLIP-seq
MIRT1556389	hsa-miR-2277-3p	CLIP-seq
MIRT1556390	hsa-miR-2392	CLIP-seq
MIRT1995615	hsa-miR-3153	CLIP-seq
MIRT1995616	hsa-miR-3175	CLIP-seq
MIRT1556392	hsa-miR-3605-5p	CLIP-seq
MIRT1995621	hsa-miR-4716-3p	CLIP-seq
MIRT1995622	hsa-miR-4723-5p	CLIP-seq
MIRT1995624	hsa-miR-4763-3p	CLIP-seq
MIRT1995625	hsa-miR-4773	CLIP-seq
MIRT1995626	hsa-miR-486-3p	CLIP-seq

Show/Hide all (52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000266	Process	Mitochondrial fission	IBA
GO:0000266	Process	Mitochondrial fission	IDA	16118244, 17545159, 18845145, 23283981
GO:0000266	Process	Mitochondrial fission	IEA
GO:0000266	Process	Mitochondrial fission	IMP	18353969, 19864424
GO:0005515	Function	Protein binding	IPI	12861026, 16874301, 17408615, 18782765, 20826455, 21149567, 21183955, 21699783, 21701560, 25416956, 29464060, 32296183
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	17408615, 17545159, 18782765, 19864424, 20451243, 21183955
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IBA
GO:0005741	Component	Mitochondrial outer membrane	IDA	14996942
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	NAS	18845145
GO:0005777	Component	Peroxisome	IDA	18782765, 20451243, 23921378
GO:0005777	Component	Peroxisome	IEA
GO:0005777	Component	Peroxisome	ISS	14561759
GO:0005778	Component	Peroxisomal membrane	IBA
GO:0005778	Component	Peroxisomal membrane	IDA	16107562, 17408615
GO:0005778	Component	Peroxisomal membrane	IEA
GO:0005778	Component	Peroxisomal membrane	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006626	Process	Protein targeting to mitochondrion	IMP	18845145
GO:0006915	Process	Apoptotic process	IEA
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007005	Process	Mitochondrion organization	IMP	21149567
GO:0007005	Process	Mitochondrion organization	IMP	18845145, 21149567
GO:0008289	Function	Lipid binding	EXP	14623186
GO:0008289	Function	Lipid binding	IBA
GO:0014850	Process	Response to muscle activity	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016559	Process	Peroxisome fission	IBA
GO:0016559	Process	Peroxisome fission	IDA	16107562, 17408615
GO:0016559	Process	Peroxisome fission	IMP	20826455
GO:0031667	Process	Response to nutrient levels	IEA
GO:0032991	Component	Protein-containing complex	IDA	17408615, 18353969, 20826455
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0042802	Function	Identical protein binding	IPI	18353969, 18845145
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043653	Process	Mitochondrial fragmentation involved in apoptotic process	IEA
GO:0060090	Function	Molecular adaptor activity	EXP	14623186
GO:0060090	Function	Molecular adaptor activity	IBA
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071396	Process	Cellular response to lipid	IEA
GO:0090141	Process	Positive regulation of mitochondrial fission	IEA
GO:0097237	Process	Cellular response to toxic substance	IEA
GO:1901653	Process	Cellular response to peptide	IEA
GO:1902617	Process	Response to fluoride	IEA
GO:1903579	Process	Negative regulation of ATP metabolic process	IMP	32521232
GO:1905395	Process	Response to flavonoid	IEA
GO:1990910	Process	Response to hypobaric hypoxia	IEA
GO:2000192	Process	Negative regulation of fatty acid transport	IMP	32521232
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IMP	21183955

MIM	HGNC	e!Ensembl
609003	21689	ENSG00000214253

Q9Y3D6

Protein name

Mitochondrial fission 1 protein (FIS1 homolog) (hFis1) (Tetratricopeptide repeat protein 11) (TPR repeat protein 11)

Protein function

Involved in the fragmentation of the mitochondrial network and its perinuclear clustering (PubMed:12783892, PubMed:12861026, PubMed:14996942, PubMed:23283981). Plays a minor role in the recruitment and association of the fission mediator dynamin

PDB

1NZN , 1PC2 , 7YA9 , 7YKA , 8U1Z , 8XWX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14852	Fis1_TPR_N	33 → 65	Fis1 N-terminal tetratricopeptide repeat	Domain
PF14853	Fis1_TPR_C	71 → 123	Fis1 C-terminal tetratricopeptide repeat	Domain

Sequence

MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEE
LLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKK
DGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS

Sequence length

152

Interactions

View interactions

	KEGG		Reactome
	Mitophagy - animal		Class I peroxisomal membrane protein import

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CEROID LIPOFUSCINOSIS, NEURONAL 1, INFANTILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEROID LIPOFUSCINOSIS, NEURONAL, 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE NEURONAL CEROID LIPOFUSCINOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-INFANTILE NEURONAL CEROID LIPOFUSCINOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURONAL CEROID-LIPOFUSCINOSES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (20)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Amyotrophic Lateral Sclerosis	Associate	31843624	★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Associate	22529290	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Associate	23333625	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Associate	30404157	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Associate	28463235	★★★★★ ★☆☆☆☆ Found in Text Mining only
Charcot Marie Tooth Disease	Associate	21890626	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue	Associate	23047795, 24786901	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Associate	30566949	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Associate	21257639	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Inhibit	31843624	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	29979990	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	24416201, 29979990	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Associate	30656603, 38103512	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Congenital Megaconial Type	Associate	34518586	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Stimulate	30566949	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nerve Degeneration	Associate	21257639	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	23047795	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Associate	35359935	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Associate	37962528	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Associate	30656603	★★★★★ ★☆☆☆☆ Found in Text Mining only

FIS1 (fission, mitochondrial 1)