Gene Gene information from NCBI Gene database.
Entrez ID 51023
Gene name Mitochondrial ribosomal protein S18C
Gene symbol MRPS18C
Synonyms (NCBI Gene)
CGI-134MRP-S18-1MRP-S18-cMRPS18-1S18mt-cbS18mmrps18-c
Chromosome 4
Chromosome location 4q21.23
Summary Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
miRNA miRNA information provided by mirtarbase database.
80
miRTarBase ID miRNA Experiments Reference
MIRT620664 hsa-miR-5096 HITS-CLIP 23824327
MIRT620663 hsa-miR-335-3p HITS-CLIP 23824327
MIRT620662 hsa-miR-513a-3p HITS-CLIP 23824327
MIRT620661 hsa-miR-513c-3p HITS-CLIP 23824327
MIRT620664 hsa-miR-5096 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
GO ID Ontology Definition Evidence Reference
GO:0003735 Function Structural constituent of ribosome IBA
GO:0003735 Function Structural constituent of ribosome IEA
GO:0003735 Function Structural constituent of ribosome NAS 11279123
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611983 16633 ENSG00000163319
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y3D5
Protein name Small ribosomal subunit protein bS18m (28S ribosomal protein S18-1, mitochondrial) (MRP-S18-1) (28S ribosomal protein S18c, mitochondrial) (MRP-S18-c) (Mrps18-c) (S18mt-c) (Small ribosomal subunit protein bS18c)
PDB 3J9M , 6NU2 , 6NU3 , 6RW4 , 6RW5 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5I , 7A5K , 7L08 , 7OG4 , 7P2E , 7PNX , 7PNY , 7PNZ , 7PO0 , 7PO1 , 7PO2 , 7PO3 , 7QI4 , 7QI5 , 7QI6 , 8ANY , 8CSP , 8CSQ , 8CSR , 8CSS , 8CST , 8CSU , 8K2A , 8OIR , 8OIS , 8QRK , 8QRL , 8QRM , 8QRN , 8RRI , 8XT0 , 8XT2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01084 Ribosomal_S18 69 120 Ribosomal protein S18 Family
Sequence
MAAVVAVCGGLGRKKLTHLVTAAVSLTHPGTHTVLWRRGCSQQVSSNEDLPISMENPYKE
PLKKCILCGKHVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFM
PVTYKDPAYLKDPKVCNIRYRE
Sequence length 142
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Ribosome   Mitochondrial translation elongation
Mitochondrial translation termination