Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51023
Gene name Gene Name - the full gene name approved by the HGNC.
Mitochondrial ribosomal protein S18C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MRPS18C
Synonyms (NCBI Gene) Gene synonyms aliases
CGI-134, MRP-S18-1, MRP-S18-c, MRPS18-1, S18mt-c, bS18m, mrps18-c
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q21.23
Summary Summary of gene provided in NCBI Entrez Gene.
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT620664 hsa-miR-5096 HITS-CLIP 23824327
MIRT620663 hsa-miR-335-3p HITS-CLIP 23824327
MIRT620662 hsa-miR-513a-3p HITS-CLIP 23824327
MIRT620661 hsa-miR-513c-3p HITS-CLIP 23824327
MIRT620664 hsa-miR-5096 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003735 Function Structural constituent of ribosome IBA 21873635
GO:0003735 Function Structural constituent of ribosome NAS 11279123
GO:0005743 Component Mitochondrial inner membrane TAS
GO:0005763 Component Mitochondrial small ribosomal subunit IBA 21873635
GO:0005763 Component Mitochondrial small ribosomal subunit IDA 11279123, 25838379
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611983 16633 ENSG00000163319
Protein
UniProt ID Q9Y3D5
Protein name Small ribosomal subunit protein bS18m (28S ribosomal protein S18-1, mitochondrial) (MRP-S18-1) (28S ribosomal protein S18c, mitochondrial) (MRP-S18-c) (Mrps18-c) (S18mt-c) (Small ribosomal subunit protein bS18c)
PDB 3J9M , 6NU2 , 6NU3 , 6RW4 , 6RW5 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5I , 7A5K , 7L08 , 7OG4 , 7P2E , 7PNX , 7PNY , 7PNZ , 7PO0 , 7PO1 , 7PO2 , 7PO3 , 7QI4 , 7QI5 , 7QI6 , 8ANY , 8CSP , 8CSQ , 8CSR , 8CSS , 8CST , 8CSU , 8K2A , 8OIR , 8OIS , 8QRK , 8QRL , 8QRM , 8QRN , 8RRI , 8XT0 , 8XT2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01084 Ribosomal_S18 69 120 Ribosomal protein S18 Family
Sequence
MAAVVAVCGGLGRKKLTHLVTAAVSLTHPGTHTVLWRRGCSQQVSSNEDLPISMENPYKE
PLKKCILCGKHVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFM
PVTYKDPAYLKDPKVCNIRYRE
Sequence length 142
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Ribosome   Mitochondrial translation elongation
Mitochondrial translation termination