PCDH8 (protocadherin 8)

Gene

• Entrez ID: 5100
• Gene name: Protocadherin 8
• Gene symbol: PCDH8
• Synonyms (NCBI Gene): ARCADLIN, PAPC
• Chromosome: 13
• Chromosome location: 13q14.3
• Summary: This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The gene encodes an integral membrane protein that is thought to function in cell adhesion in a CNS-specific manner. Unlike classical cadherins, which are general

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000773	hsa-miR-200a-3p	Microarray, Northern blot	16331254
MIRT1216895	hsa-miR-141	CLIP-seq
MIRT1216896	hsa-miR-200a	CLIP-seq
MIRT1216897	hsa-miR-300	CLIP-seq
MIRT1216898	hsa-miR-381	CLIP-seq
MIRT1216899	hsa-miR-4666-3p	CLIP-seq
MIRT1216900	hsa-miR-1271	CLIP-seq
MIRT1216901	hsa-miR-129-5p	CLIP-seq
MIRT1216902	hsa-miR-1324	CLIP-seq
MIRT1216903	hsa-miR-182	CLIP-seq
MIRT1216904	hsa-miR-218	CLIP-seq
MIRT1216905	hsa-miR-3121-5p	CLIP-seq
MIRT1216906	hsa-miR-4275	CLIP-seq
MIRT1216907	hsa-miR-4318	CLIP-seq
MIRT1216908	hsa-miR-4436b-5p	CLIP-seq
MIRT1216909	hsa-miR-4693-5p	CLIP-seq
MIRT1216910	hsa-miR-511	CLIP-seq
MIRT1216911	hsa-miR-513a-3p	CLIP-seq
MIRT1216912	hsa-miR-556-3p	CLIP-seq
MIRT1216913	hsa-miR-600	CLIP-seq
MIRT1216914	hsa-miR-636	CLIP-seq
MIRT1216915	hsa-miR-892a	CLIP-seq
MIRT1216916	hsa-miR-96	CLIP-seq
MIRT2062604	hsa-miR-101	CLIP-seq
MIRT2062605	hsa-miR-450b-5p	CLIP-seq
MIRT2062606	hsa-miR-518a-5p	CLIP-seq
MIRT2062607	hsa-miR-527	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001756	Process	Somitogenesis	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005886	Component	Plasma membrane	TAS	9787079
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0007155	Process	Cell adhesion	IBA	21873635
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0007267	Process	Cell-cell signaling	TAS	9787079
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0016331	Process	Morphogenesis of embryonic epithelium	IEA
GO:0030425	Component	Dendrite	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099055	Component	Integral component of postsynaptic membrane	IEA
GO:0099179	Process	Regulation of synaptic membrane adhesion	IEA

Other IDs

• MIM: 603580
• HGNC: 8660
• e!Ensembl: ENSG00000136099

Protein

• UniProt ID: O95206
• Protein name: Protocadherin-8 (Arcadlin)
• Protein function: Calcium-dependent cell-adhesion protein (By similarity). May play a role in activity-induced synaptic reorganization underlying long term memory (By similarity). Could be involved in CDH2 internalization through TAOK2/p38 MAPK pathway. In hippoc
• PDB: 6VFV
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08266	Cadherin_2	31 → 111	Cadherin-like	Domain
  PF00028	Cadherin	140 → 236	Cadherin domain	Domain
  PF00028	Cadherin	251 → 345	Cadherin domain	Domain
  PF00028	Cadherin	398 → 488	Cadherin domain	Domain
  PF00028	Cadherin	502 → 600	Cadherin domain	Domain
  PF00028	Cadherin	619 → 711	Cadherin domain	Domain

• Sequence:

  MSPVRRWGSPCLFPLQLFSLCWVLSVAQSKTVRYSTFEEDAPGTVIGTLAEDLHMKVSGD
  TSFRLMKQFNSSLLRVREGDGQLTVGDAGLDRERLCGQAPQCVLAFDVVSFSQEQFRLVH
  VEVEVRDVNDHAPRFPRAQIPVEVSEGAAVGTRIPLEVPVDEDVGANGLQTVRLAEPHSP
  FRVELQTRADGAQCADLVLLQELDRESQAAYSLELVAQDGGRPPRSATAALSVRVLDAND
  HSPAFPQGAVAEVELAEDAPVGSLLLDLDAADPDEGPNGDVVFAFGARTPPEARRLFRLD
  PRSGRLTLAGPVDYERQDTYELDVRAQDRGPGPRAATCKVIVRIRDVNDNAPDIAITPLA
  APGAPATSPFAAAAAAAALGGADASSPAGAGTPEAGATSLVPEGAARESLVALVSTSDRD
  SGANGQVRCALYGHEHFRLQPAYAGSYLVVTAASLDRERIAEYNLTLVAEDRGAPPLRTV
  RPYTVRVGDENDNAPLFTRPVYEVSVRENNPPGAYLATVAARDRDLGRNGQVTYRLLEAE
  VGRAGGAVSTYVSVDPATGAIYALRSFDYETLRQLDVRIQASDGGSPQLSSSALVQVRVL
  DQNDHAPVLVHPAPANGSLEVAVPGRTAKDTVVARVQARDADEGANGELAFELQQQEPRE
  AFAIGRRTGEILLTGDLSQEPPGRVFRALLVISDGGRPPLTTTATVSFVVTAGGGRGPAA
  PASAGSPERSRPPGSRLGVSGSVLQWDTPLIVIIVLAGSCTLLLAAIIAIATTCNRRKKE
  VRKGGALREERPGAAGGGASAPGSPEEAARGAGPRPNMFDVLTFPGTGKAPFGSPAADAP
  PPAVAAAEVPGSEGGSATGESACHFEGQQRLRGAHAEPYGASPGFGKEPAPPVAVWKGHS
  FNTISGREAEKFSGKDSGKGDSDFNDSDSDISGDALKKDLINHMQSGLWACTAECKILGH
  SDRCWSPSCSGPNAHPSPHPPAQMSTFCKSTSLPRDPLRRDNYYQAQLPKTVGLQSVYEK
  VLHRDYDRTVTLLSPPRPGRLPDLQEIGVPLYQSPPGRYLSPKKGANENV

• Sequence length: 1070

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158, rs80357524, rs80357115, rs80357945, rs80357729, rs80357609, rs80357259, rs80357981, rs80358063, rs80357389, rs80356862, rs80359876, rs80357580, rs80358053, rs80358089, rs80187739, rs397507241, rs80358069, rs80357590, rs80357284, rs80357941, rs80359261, rs80359272, rs80359276, rs276174813, rs80358474, rs80359316, rs1555282969, rs80359388, rs80359499, rs80359505, rs80359520, rs80359526, rs80359533, rs56253082, rs80358824, rs80359554, rs80359636, rs80359651, rs80359659, rs80359011, rs80359012, rs80359013, rs80359718, rs397507410, rs81002812, rs80359730, rs80359152, rs80359159, rs397507419, rs28897759, rs80359211, rs80359775, rs397514577, rs397507584, rs80358435, rs80358456, rs80359340, rs80359343, rs80359365, rs80358579, rs397507670, rs80358593, rs80359406, rs80359444, rs80359454, rs276174853, rs276174854, rs80359483, rs80359537, rs80358815, rs80358843, rs80359558, rs80359560, rs80359594, rs80358893, rs28897743, rs397507900, rs397507906, rs397507918, rs80358971, rs80358981, rs397507941, rs80359030, rs80359035, rs41293511, rs397507396, rs81002806, rs80359112, rs397508006, rs81002893, rs45580035, rs80359760, rs397508051, rs80359772, rs4987049, rs80359777, rs80357770, rs397508867, rs62625303, rs397508874, rs80357506, rs80357287, rs273898674, rs80358042, rs80358083, rs80357058, rs41286296, rs80357960, rs80356945, rs80357223, rs386134270, rs80358116, rs80357856, rs80357424, rs397509050, rs80357485, rs80357966, rs397509067, rs80357310, rs80356866, rs80357260, rs80357437, rs80358023, rs80358086, rs80357133, rs80356993, rs80357997, rs80357239, rs80357227, rs397509243, rs80356969, rs80356959, rs63750617, rs63751319, rs587779315, rs200640585, rs398122546, rs80357543, rs398122687, rs80359328, rs398122779, rs398122783, rs62517194, rs80358029, rs515726060, rs180177103, rs180177111, rs180177133, rs587776527, rs180177135, rs180177136, rs515726117, rs587779813, rs587779909, rs587780024, rs587780100, rs28909982, rs121908698, rs180177100, rs587780210, rs587780240, rs587780639, rs587781269, rs587781353, rs587781471, rs587781658, rs587781697, rs587781730, rs587781894, rs587781948, rs587782005, rs587782011, rs200928781, rs587781558, rs370228071, rs587782245, rs587782401, rs180177110, rs587782504, rs72552322, rs587782531, rs587782620, rs587782680, rs587782774, rs587782818, rs730881411, rs730881389, rs564652222, rs397507768, rs587776419, rs730881868, rs730881940, rs56383036, rs758972589, rs201089102, rs730881348, rs786202608, rs786201886, rs786203318, rs786203775, rs786203714, rs786202033, rs750621215, rs786203884, rs786203650, rs772821016, rs863224521, rs864622223, rs864622655, rs375699023, rs876659572, rs768362387, rs876659535, rs876658957, rs483353072, rs876659435, rs267608041, rs876661113, rs730881369, rs878853535, rs772228129, rs878855122, rs760551339, rs80359596, rs397509222, rs886039630, rs886039683, rs886040828, rs587781799, rs886040374, rs886040649, rs397507967, rs878854957, rs886040043, rs1057517589, rs1060502769, rs866380588, rs863224765, rs1064793243, rs747563556, rs1555074976, rs1064795885, rs753961188, rs1064794708, rs869312772, rs1064793887, rs1131690820, rs1135401928, rs1135401868, rs1135401859, rs1553370324, rs397507630, rs1555283160, rs1555283251, rs1555283262, rs1555283361, rs1555286298, rs1555288462, rs886040950, rs1555289566, rs776323117, rs80357123, rs1555579627, rs1555580697, rs80358054, rs1555593302, rs1328985852, rs763470424, rs1555139694, rs878854697, rs1555461217, rs1555461765, rs774684620, rs766416564, rs1554558613, rs1305740166, rs1555461460, rs1555461407, rs1555461586, rs1555567202, rs1555607022, rs1555069815, rs1442299125, rs1474786480, rs1555084947, rs1555457867, rs141087784, rs1482641121, rs1564830522, rs1565469955, rs1565503137, rs864622613, rs755263466, rs757679199, rs1593903166, rs1597801649, rs1603293306, rs879253880, rs80358754, rs1597062038, rs45494092, rs1603275367, rs887358871, rs1597091518, rs1966967065, rs1064793049, rs2082872908, rs2085078278, rs2072475243
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	19208208
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	12884975

Associations from Text Mining
Disease Name	Relationship Type	References
Autistic Disorder	Associate	25574603
Breast Neoplasms	Inhibit	33899544
Carcinoma Renal Cell	Associate	25416427, 34689221
Deafness	Associate	21505449
Diabetes Mellitus Type 2	Associate	24684796
Hypopharyngeal Neoplasms	Inhibit	29865037
Infections	Associate	30391630
Lymphatic Metastasis	Associate	25416427, 25486497, 29026066
MASS syndrome	Associate	36555747
Neoplasms	Associate	23569129, 25486497, 29865037, 34689221
Neoplasms	Inhibit	25927589
Non Muscle Invasive Bladder Neoplasms	Associate	25927589
Parkinson Disease	Associate	26961748, 38272954
Prostatic Neoplasms	Associate	25486497, 29026066
Psychomotor Disorders	Associate	21505449, 22909775
Urinary Bladder Neoplasms	Associate	23569129
Urinary Tract Infections	Associate	30391630