FOXP3 (forkhead box P3)

Gene

• Entrez ID: 50943
• Gene name: Forkhead box P3
• Gene symbol: FOXP3
• Synonyms (NCBI Gene): AIID, DIETER, IPEX, JM2, PIDX, XPID
• Chromosome: X
• Chromosome location: Xp11.23
• Summary: The protein encoded by this gene is a member of the forkhead/winged-helix family of transcriptional regulators. Defects in this gene are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX), also known as X-linked autoim

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs17847095	C>A	Pathogenic, benign	Coding sequence variant, missense variant
rs28935477	G>A	Pathogenic	Coding sequence variant, missense variant
rs122467169	A>C	Pathogenic	Coding sequence variant, missense variant
rs122467170	C>T	Pathogenic	Coding sequence variant, missense variant
rs122467171	CCT>-	Pathogenic	Coding sequence variant, inframe deletion
rs122467172	AA>GC	Pathogenic	Coding sequence variant, missense variant
rs122467173	A>G	Pathogenic	Coding sequence variant, missense variant
rs122467174	C>T	Pathogenic	Coding sequence variant, initiator codon variant, missense variant
rs122467175	A>G	Pathogenic	Coding sequence variant, missense variant
rs782377881	G>A,T	Likely-pathogenic	Stop gained, coding sequence variant, synonymous variant
rs782511378	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs782528935	G>A,T	Likely-pathogenic	Coding sequence variant, missense variant
rs797045588	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs886041596	C>A,G	Likely-pathogenic, pathogenic	Splice donor variant
rs886044787	G>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1057517736	G>A	Pathogenic	Coding sequence variant, stop gained
rs1057518281	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1057520529	C>T	Pathogenic	Missense variant, coding sequence variant
rs1064795069	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1426535368	T>A,C	Pathogenic	Intron variant
rs1557115532	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1557115786	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1557116163	TCT>-	Likely-pathogenic	Inframe deletion, coding sequence variant
rs1569529565	ACA>G	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1569529715	A>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1602679037	AG>-	Pathogenic	Terminator codon variant, frameshift variant
rs1602679681	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1602684221	C>T	Likely-pathogenic	Splice acceptor variant
rs1602684496	G>T	Pathogenic	Coding sequence variant, missense variant
rs1602693008	C>A	Pathogenic	Genic upstream transcript variant, splice donor variant, upstream transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001180	hsa-miR-31-5p	qRT-PCR, Luciferase reporter assay, Western blot	19408243
MIRT001180	hsa-miR-31-5p	Luciferase reporter assay	19408243
MIRT001180	hsa-miR-31-5p	qRT-PCR	24855107
MIRT001180	hsa-miR-31-5p	qRT-PCR	24855107
MIRT731428	rno-miR-125a-5p	Luciferase reporter assay	26875774
MIRT731428	rno-miR-125a-5p	Luciferase reporter assay	26875774
MIRT733221	hsa-miR-150-5p	Immunohistochemistry (IHC), Luciferase reporter assay, Microarray, Western blotting	33723215
MIRT734339	hsa-miR-23a-3p	Microarray, qRT-PCR	31611205
MIRT734340	hsa-miR-34a-5p	Microarray, qRT-PCR	31611205
MIRT734878	hsa-miR-101-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR	33438204
MIRT736780	hsa-miR-155-3p	qRT-PCR	32366887
MIRT1003495	hsa-miR-1200	CLIP-seq
MIRT1003496	hsa-miR-4324	CLIP-seq
MIRT1003497	hsa-miR-4330	CLIP-seq
MIRT1003498	hsa-miR-544b	CLIP-seq
MIRT2449874	hsa-miR-1272	CLIP-seq
MIRT2449875	hsa-miR-1275	CLIP-seq
MIRT2449876	hsa-miR-1322	CLIP-seq
MIRT2449877	hsa-miR-3201	CLIP-seq
MIRT2449878	hsa-miR-4525	CLIP-seq
MIRT2449879	hsa-miR-4665-5p	CLIP-seq
MIRT2449880	hsa-miR-4723-5p	CLIP-seq
MIRT2449881	hsa-miR-4728-5p	CLIP-seq
MIRT2449882	hsa-miR-4791	CLIP-seq
MIRT2449883	hsa-miR-625	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
IRF1	Repression	18641303
MSC	Activation	19561533
NFATC2	Activation	16517728
NFKB1	Activation	20462637
PGR	Repression	18685848
RELA	Activation	20462637
RELA	Unknown	23178569
SIRT1	Unknown	21533107
SMAD3	Activation	20937549
SP3	Repression	20462637
STAT1	Unknown	19124747
VDR	Unknown	22529297

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	19276356
GO:0001782	Process	B cell homeostasis	IEA
GO:0001818	Process	Negative regulation of cytokine production	IDA	11483607
GO:0002262	Process	Myeloid cell homeostasis	IEA
GO:0002361	Process	CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation	IEA
GO:0002362	Process	CD4-positive, CD25-positive, alpha-beta regulatory T cell lineage commitment	TAS	18368049
GO:0002456	Process	T cell mediated immunity	IEA
GO:0002507	Process	Tolerance induction	IEA
GO:0002513	Process	Tolerance induction to self antigen	IEA
GO:0002517	Process	T cell tolerance induction	IEA
GO:0002637	Process	Regulation of immunoglobulin production	IEA
GO:0002666	Process	Positive regulation of T cell tolerance induction	IEA
GO:0002667	Process	Regulation of T cell anergy	IEA
GO:0002667	Process	Regulation of T cell anergy	ISS
GO:0002669	Process	Positive regulation of T cell anergy	IEA
GO:0002677	Process	Negative regulation of chronic inflammatory response	IEA
GO:0002725	Process	Negative regulation of T cell cytokine production	IDA	15466453
GO:0002725	Process	Negative regulation of T cell cytokine production	IMP	23169781
GO:0002851	Process	Positive regulation of peripheral T cell tolerance induction	IEA
GO:0002870	Process	T cell anergy	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	IMP	21458306
GO:0003700	Function	DNA-binding transcription factor activity	IDA	11483607, 32644293
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	11138001
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0005515	Function	Protein binding	IPI	16652169, 17360565, 17377532, 18354202, 18368049, 20676092, 23396208, 23543754, 23973223, 24012345, 25096571, 25416956, 25910212, 29892012, 30510991, 31515488, 32296183, 32644293, 34019767
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	32644293
GO:0005634	Component	Nucleus	IDA	11483607, 16873067, 16920951, 22678915, 24012345
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	16903909
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	22678915
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	16903909
GO:0005829	Component	Cytosol	IDA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006338	Process	Chromatin remodeling	NAS	16903909
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	11138001
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	15652505
GO:0009615	Process	Response to virus	IEP	20583921
GO:0010467	Process	Gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0014045	Process	Establishment of endothelial blood-brain barrier	IEA
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IDA	16652169
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032689	Process	Negative regulation of type II interferon production	IDA	15466453
GO:0032689	Process	Negative regulation of type II interferon production	IEA
GO:0032689	Process	Negative regulation of type II interferon production	IMP	23169781
GO:0032693	Process	Negative regulation of interleukin-10 production	IDA	15466453
GO:0032693	Process	Negative regulation of interleukin-10 production	IEA
GO:0032700	Process	Negative regulation of interleukin-17 production	IEA
GO:0032700	Process	Negative regulation of interleukin-17 production	IMP	18368049
GO:0032703	Process	Negative regulation of interleukin-2 production	IDA	15466453, 17360565, 17377532
GO:0032703	Process	Negative regulation of interleukin-2 production	IEA
GO:0032703	Process	Negative regulation of interleukin-2 production	IMP	16873067, 23169781
GO:0032713	Process	Negative regulation of interleukin-4 production	IDA	15466453
GO:0032713	Process	Negative regulation of interleukin-4 production	IEA
GO:0032714	Process	Negative regulation of interleukin-5 production	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	IEA
GO:0032792	Process	Negative regulation of CREB transcription factor activity	IDA	16652169
GO:0032831	Process	Positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation	IEA
GO:0032831	Process	Positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation	TAS	18368049
GO:0032905	Process	Transforming growth factor beta1 production	IEA
GO:0032914	Process	Positive regulation of transforming growth factor beta1 production	IEA
GO:0032991	Component	Protein-containing complex	NAS	16903909
GO:0033080	Process	Immature T cell proliferation in thymus	IEA
GO:0033092	Process	Positive regulation of immature T cell proliferation in thymus	IEA
GO:0035035	Function	Histone acetyltransferase binding	IPI	17360565
GO:0035739	Process	CD4-positive, alpha-beta T cell proliferation	IEA
GO:0042098	Process	T cell proliferation	IEA
GO:0042110	Process	T cell activation	IDA	15466453
GO:0042110	Process	T cell activation	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IDA	15466453
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IMP	21458306, 23169781
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	21458306
GO:0042803	Function	Protein homodimerization activity	IPI	16920951
GO:0042826	Function	Histone deacetylase binding	IPI	17360565
GO:0043029	Process	T cell homeostasis	NAS	11483607
GO:0043367	Process	CD4-positive, alpha-beta T cell differentiation	IEA
GO:0043372	Process	Positive regulation of CD4-positive, alpha-beta T cell differentiation	IEA
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IDA	16873067
GO:0043565	Function	Sequence-specific DNA binding	IDA	11483607, 16873067, 19276356
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045066	Process	Regulatory T cell differentiation	IDA	32644293
GO:0045066	Process	Regulatory T cell differentiation	IEA
GO:0045591	Process	Positive regulation of regulatory T cell differentiation	IDA	30513302
GO:0045591	Process	Positive regulation of regulatory T cell differentiation	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	11483607, 16920951, 17360565, 22678915
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	21458306, 23169781
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	15466453
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	21458306, 23169781
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	19276356
GO:0046007	Process	Negative regulation of activated T cell proliferation	NAS	11483607
GO:0046633	Process	Alpha-beta T cell proliferation	IEA
GO:0046642	Process	Negative regulation of alpha-beta T cell proliferation	IEA
GO:0046651	Process	Lymphocyte proliferation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048289	Process	Isotype switching to IgE isotypes	IEA
GO:0048294	Process	Negative regulation of isotype switching to IgE isotypes	IEA
GO:0048302	Process	Regulation of isotype switching to IgG isotypes	IEA
GO:0050672	Process	Negative regulation of lymphocyte proliferation	IEA
GO:0050687	Process	Negative regulation of defense response to virus	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050777	Process	Negative regulation of immune response	IDA	15652505
GO:0050852	Process	T cell receptor signaling pathway	IEA
GO:0051059	Function	NF-kappaB binding	NAS	16652169
GO:0051525	Function	NFAT protein binding	IPI	16873067, 21458306
GO:1901355	Process	Response to rapamycin	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000320	Process	Negative regulation of T-helper 17 cell differentiation	IMP	23169781
GO:2000562	Process	Negative regulation of CD4-positive, alpha-beta T cell proliferation	IEA

Other IDs

• MIM: 300292
• HGNC: 6106
• e!Ensembl: ENSG00000049768

Protein

• UniProt ID: Q9BZS1
• Protein name: Forkhead box protein P3 (Scurfin) [Cleaved into: Forkhead box protein P3, C-terminally processed; Forkhead box protein P3 41 kDa form]
• Protein function: Transcriptional regulator which is crucial for the development and inhibitory function of regulatory T-cells (Treg) (PubMed:17377532, PubMed:21458306, PubMed:23947341, PubMed:24354325, PubMed:24722479, PubMed:24835996, PubMed:30513302, PubMed:32
• PDB: 3QRF, 4WK8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16159	FOXP-CC	193 → 261	FOXP coiled-coil domain	Domain
  PF00250	Forkhead	336 → 417	Forkhead domain	Domain

• Sequence:

  MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSS
  LNPMPPSQLQLPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQV
  HPLESPAMISLTPPTTATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKD
  STLSAVPQSSYPLLANGVCKWPGCEKVFEEPEDFLKHCQADHLLDEKGRAQCLLQREMVQ
  SLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCIVAAGSQGPVVPAWSGPRE
  APDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTL
  NEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQR
  PSRCSNPTPGP

• Sequence length: 431

Pathways

KEGG:

Th17 cell differentiation
Inflammatory bowel disease

Reactome:

RUNX1 and FOXP3 control the development of regulatory T lymphocytes (Tregs)
RUNX1 regulates transcription of genes involved in WNT signaling

Associated diseases

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Centronuclear myopathy	Pathogenic	rs2519196832	RCV004587624
FOXP3-related disorder	Likely pathogenic; Pathogenic	rs2519197052, rs2519185876, rs2519192078, rs1057520529, rs1557115532	RCV003402483 RCV003408398 RCV003982673 RCV003897856 RCV003392329
Hydrops fetalis	Pathogenic; Likely pathogenic	rs28935477, rs2066032846	RCV001290142 RCV001257372
Insulin-dependent diabetes mellitus secretory diarrhea syndrome	Pathogenic; Likely pathogenic	rs2147949202, rs2147944391, rs2147944159, rs2147947315, rs2147949090, rs2147949777, rs2147948858, rs2147944106, rs797045588, rs782528935, rs2519194123, rs2519194266, rs28935477, rs2147944039, rs122467169, rs122467170, rs1602679037, rs122467171, rs2147949186, rs122467172, rs122467174, rs122467175, rs886044787, rs2066083033, rs2519186384, rs1057520529, rs1557115532, rs1557116163, rs886041596, rs1569529565, rs1569529715, rs1557115786, rs1602684221, rs1602693008, rs2066088072, rs2066044949	RCV001420358 RCV002035836 RCV002022751 RCV001982984 RCV002029367 RCV001987185 RCV002012477 RCV002249996 RCV000194536 RCV000193687 RCV003143293 RCV003226056 RCV000012160 RCV000012161 RCV000012162 RCV000012163 RCV000012164 RCV000012166 RCV000012167 RCV000012168 RCV000012171 RCV000012172 RCV001380270 RCV003468224 RCV003461593 RCV003227748 RCV000504127 RCV001380271 RCV000697871 RCV000690380 RCV000701902 RCV000801492 RCV000825005 RCV000853242 RCV001035787 RCV001224826 RCV001204541
Multinucleated neurons-anhydramnios-renal dysplasia-cerebellar hypoplasia-hydranencephaly syndrome	Likely pathogenic	rs2147947553	RCV001375952
Neurodevelopmental disorder	Likely pathogenic; Pathogenic	rs2066044949	RCV003389067
Non-obstructive azoospermia	Pathogenic	rs1602684496	RCV000999511

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Acute myeloid leukemia	Benign	rs190739204	RCV005909434
Diabetes mellitus type 1	Conflicting classifications of pathogenicity; Uncertain significance	rs782511378, rs2066088699	RCV000258798 RCV001281015
Malignant tumor of esophagus	Benign	rs190739204	RCV005909435
Monogenic diabetes	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity	rs1057524899, rs199917616, rs781861708	RCV000445467 RCV000664161 RCV001174438
Thyroid cancer, nonmedullary, 1	Likely benign; Benign	rs782085584, rs2232369	RCV005912740 RCV005927861

Associations from Text Mining
Disease Name	Relationship Type	References
Abnormalities Drug Induced	Associate	33057635
Abortion Habitual	Inhibit	26345847, 32429643
Abortion Habitual	Associate	35767890
Acquired Immunodeficiency Syndrome	Associate	33974229
Acute Coronary Syndrome	Associate	25740578, 27999237
Acute Coronary Syndrome	Inhibit	29259350
Acute Disease	Associate	28643491
Acute Lung Injury	Associate	31754335
Acute On Chronic Liver Failure	Associate	25024610, 34869773
Adenocarcinoma	Associate	28831395, 37970475
Adenocarcinoma of Lung	Associate	23269987, 26676638, 26851185, 28831395, 32603557, 33684161, 34496829, 36550816, 37532692, 37589509
Adenocarcinoma Scirrhous	Associate	22569001
Agammaglobulinemia	Associate	37936298
Allergic Fungal Sinusitis	Inhibit	20598643
Alopecia Areata	Associate	23196741
Anemia Aplastic	Inhibit	17463169
Anemia Aplastic	Associate	27702400, 36469034
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	24648606, 31164680
Antiphospholipid Syndrome	Inhibit	25862984
Antiphospholipid Syndrome	Associate	30894863
Aphasia Conduction	Associate	23667456
Arsenic Poisoning	Associate	36464704
Arthralgia	Associate	35767890
Arthritis	Associate	23450683, 25092890, 26076982, 26561546
Arthritis Juvenile	Associate	17469159, 23121667, 25092890, 26561546, 35410224, 37741520
Arthritis Psoriatic	Associate	36450783
Arthritis Rheumatoid	Inhibit	16537805, 21496382, 25164131, 28376277
Arthritis Rheumatoid	Associate	17392348, 19886735, 21926327, 22488116, 23280063, 24288552, 24452947, 24990235, 25042153, 27241313, 27421886, 27667787, 27834806, 28751821, 30954385, 30990587, 32111105, 32245307, 35764071
Arthritis Rheumatoid	Stimulate	26314565
Asthma	Stimulate	17349011
Asthma	Inhibit	23573194
Asthma	Associate	29317916, 36981683
Atherosclerosis	Associate	26383248, 26822994, 27999237, 31430072
Autoimmune Diseases	Associate	17463169, 18599794, 19155519, 19299332, 19738030, 20190142, 20370571, 21828127, 22264504, 22294730, 22489829, 22736020, 22855503, 23223361, 23249428, 23432692, 24610777, 24784317, 25425428, 26063731, 26414764, 26441347, 26684629, 27211045, 27619682, 27702400, 27892628, 28298239, 28813651, 30027704, 30723474, 31808541, 32362325, 32646440, 32738192, 33274669, 33978826, 35479070, 35767890, 36717877, 37933083, 38201281
Autoimmune Diseases	Inhibit	22152480, 22392608, 29730990, 33746959
Autoimmune Diseases	Stimulate	28747257
Autoimmune enteropathy	Associate	17416586, 18820676, 18931102, 21595732, 21865090, 23223361, 24792626, 29193502, 29907148, 34044499, 35479070, 36600150
Autoimmune Lymphoproliferative Syndrome	Associate	29686686, 34531853, 35479070, 36165514
Autoimmune polyendocrinopathy syndrome type 1	Associate	28736829
Autonomic Nervous System Diseases	Inhibit	25010330
Azoospermia	Associate	31855573
Behcet Syndrome	Associate	25873156, 32245315
Berylliosis	Inhibit	20299529
Biliary Tract Neoplasms	Associate	32878426, 36650632
Blindness	Stimulate	27278091
Blood Coagulation Disorders	Associate	33974229
Bone Marrow Diseases	Associate	32513132
Bone Resorption	Inhibit	17355249
Brain Neoplasms	Associate	34104541
Breast Neoplasms	Associate	18294387, 18566447, 18685848, 18820666, 19604349, 20075077, 20229175, 20306312, 21649468, 22431701, 22471961, 23034170, 23169287, 23320561, 23502335, 24124553, 24338714, 24562936, 25193543, 26942414, 26979828, 27473163, 28029650, 28388539, 28562349, 28621227, 28713192, 28963773, 29241196, 29286921, 29405562, 29549328, 29615076, 29929548, 30011797, 30221739, 31852159, 32222891, 32580398, 32810665, 32939056, 33623115, 34365471, 34382943, 35120331, 35130925, 35614183, 36093688, 36437379, 36799186, 40108523
Breast Neoplasms	Inhibit	22479588, 24338714, 34768829
Breast Neoplasms	Stimulate	30484986
Bronchiolitis Obliterans Syndrome	Inhibit	15972448, 20628341
Bronchiolitis Obliterans Syndrome	Stimulate	21494640
Bronchiolitis Obliterans Syndrome	Associate	21669298, 21900196, 24577531, 29197137
Bronchitis Chronic	Inhibit	23514217
Burkitt Lymphoma	Associate	28033393
Calcinosis Cutis	Associate	18820132, 24885770, 29620159, 37612267
Carcinogenesis	Associate	18510697, 36870289
Carcinogenesis	Inhibit	26823784
Carcinoma	Inhibit	19220831
Carcinoma Basal Cell	Associate	17508019, 27117439, 33623115
Carcinoma Ductal	Associate	21649468, 22471961, 23529839
Carcinoma Hepatocellular	Stimulate	17372588
Carcinoma Hepatocellular	Associate	18793383, 20346216, 21086571, 21251418, 23423978, 23526963, 23759077, 24761872, 25552913, 25907075, 26437631, 31006654, 31227589, 31903159, 33441885, 34092607, 34593621, 34605709, 36157928, 37056769, 37531206, 39838375
Carcinoma Intraductal Noninfiltrating	Stimulate	18685848
Carcinoma Intraductal Noninfiltrating	Associate	26249178, 32203210
Carcinoma Merkel Cell	Associate	34071045, 37573372
Carcinoma Non Small Cell Lung	Associate	20234320, 23098499, 26460798, 27000869, 27463005, 29436663, 29959381, 30297881, 30956278, 31134811, 31983096, 32066909, 33149213, 34995050, 36550816
Carcinoma Ovarian Epithelial	Associate	19641607
Carcinoma Ovarian Epithelial	Stimulate	19673890
Carcinoma Pancreatic Ductal	Associate	24797069, 25669968, 26858311, 27329602, 31381571, 34758773, 36650632, 40269781
Carcinoma Renal Cell	Associate	19188179, 19454729, 22143939, 25824786, 28939740, 32469992, 34081621, 36932108, 37940428
Carcinoma Renal Cell	Inhibit	34795663
Carcinoma Signet Ring Cell	Associate	22569001
Carcinoma Squamous Cell	Associate	19220831, 21200385, 22438899, 23572151, 35358193, 36550816
Carcinosarcoma	Associate	34876047
Cardiomyopathy Dilated	Stimulate	21422001
Cardiomyopathy Dilated	Associate	28207945, 34669781
Cardiovascular Diseases	Associate	27499494, 35767890, 38213254
Carotid Stenosis	Associate	33480285
Cartilage Diseases	Associate	27241313
Castleman Disease	Associate	37175521
Cavitary Optic Disc Anomalies	Associate	29472922
Celiac Disease	Associate	23874626, 28283419, 33717129, 37047806, 38415552
Celiac Disease	Inhibit	25465638
Celiac Disease	Stimulate	34895167
Chagas Cardiomyopathy	Associate	29473686
Cholangiocarcinoma	Associate	22290731, 30377340, 34526987, 35597869, 36433731
Cholangitis Sclerosing	Associate	36455145
Chordoma	Associate	29051990
Chorioamnionitis	Stimulate	27814345
Chromosome Aberrations	Associate	18246047, 29476189
Chromosome Disorders	Associate	29476189
Chronic Disease	Associate	33213373
Cleft Lip	Associate	25139022
Colitis	Associate	35563301
Colitis Associated Neoplasms	Inhibit	31048714
Colitis Ulcerative	Associate	18190460, 19292766, 22467146, 24282429, 25437819, 26333292, 27178149, 28453768, 31191543, 34160358, 34353876, 35905575
Colitis Ulcerative	Stimulate	26305224
Colonic Neoplasms	Associate	19577568, 22319577, 22879926, 30013992
Colorectal Neoplasms	Associate	18985040, 20665489, 21179245, 21818290, 21904560, 22276195, 22408358, 23382847, 23963148, 24064667, 24675384, 24938080, 25225903, 25268580, 26339391, 26439988, 27196573, 27619682, 28560891, 30013992, 30658502, 31364113, 31429779, 31488881, 31921188, 32246094, 32390702, 32449240, 33045001, 35484226, 36285512, 36960042, 38041531, 38415552, 39207001
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	31998307
Common Variable Immunodeficiency	Inhibit	17302902
Common Variable Immunodeficiency	Associate	19162554, 23432692, 27188997, 32575504
Communicable Diseases	Associate	18246047, 25425428
Condylomata Acuminata	Associate	37053156
Conjunctivitis Allergic	Associate	24368924
Coronary Artery Disease	Associate	33213373
Coronary Disease	Associate	27997991
COVID 19	Inhibit	33128792
COVID 19	Associate	33178221, 33220925, 34433692, 34478955, 34895167, 34966385, 35002537, 35663467, 36750001, 36889300, 37307689
Critical Illness	Inhibit	36889300
Crohn Disease	Associate	16045746, 21147109, 22467146, 22736020, 24289115, 25071071, 26305224, 26441347, 28623282, 29453928, 29489879, 30710380, 35905575, 38211712, 38517030
Crohn Disease	Inhibit	18422560
Cytomegalovirus Infections	Associate	28683106, 32891157
Deafness	Associate	18931102
Death	Associate	28623282, 29454648, 36429083, 36932108, 37932810
Dental Plaque	Associate	37881939
Dermatitis Atopic	Associate	22686584, 22968402, 29249119
Dermatitis Herpetiformis	Associate	25465638
Dermatomyositis	Associate	27039301
Dermatomyositis	Inhibit	29172719
Diabetes Mellitus	Associate	18931102, 21896932, 23409157, 25481456, 29193502, 29417186, 32894076, 34294806, 36600150, 36717877, 38408297
Diabetes Mellitus Congenital Autoimmune	Associate	38408297
Diabetes Mellitus Permanent Neonatal	Associate	18931102
Diabetes Mellitus Type 1	Associate	18248531, 19085184, 19141582, 19875613, 21368230, 24523574, 25481456, 25523632, 26224887, 26414764, 26473355, 26714416, 26888215, 27560779, 28053319, 29193502, 29757588, 29907148, 30723474, 31127857, 31808541, 34054801, 35058920, 35479070, 35626661, 35966054, 37164005
Diabetes Mellitus Type 1	Stimulate	18690669, 22332874, 28747257
Diabetes Mellitus Type 1	Inhibit	24677179, 31299986
Diabetes Mellitus Type 2	Associate	30270447, 36717877
Diabetes Mellitus Type 2	Inhibit	34079246
Diabetic Angiopathies	Associate	29757588
Diabetic Nephropathies	Associate	36717877
Diarrhea	Associate	28623282, 33358585, 35479070
Diffuse panbronchiolitis	Associate	24292748
DiGeorge Syndrome	Associate	23607606
Digestive System Neoplasms	Associate	37970475
Disease	Associate	18435801, 27302973, 27936497, 35479070
Disease	Stimulate	22235998
DNA Repair Deficiency Disorders	Associate	30401949
DNA Virus Infections	Associate	35800157
Down Syndrome	Stimulate	22861363
Drug Hypersensitivity	Associate	17349011
Drug Hypersensitivity	Inhibit	17694575
Drug Resistant Epilepsy	Associate	27061881, 28623282
Duodenitis	Associate	31170141
Dystonic Disorders	Stimulate	32416752
Echogenic Bowel	Associate	28317311
Eczema	Associate	22092655, 35479070
Edema	Associate	28317311
Endometrial Neoplasms	Associate	29718856, 30401949, 31348233, 39986022
Endometriosis	Associate	21481380, 22341374, 25275597
Endometriosis	Stimulate	22541024
Endometritis	Stimulate	31718829
Enterocolitis	Associate	22267598
Enterocolitis Necrotizing	Associate	24194940
Enterovirus Infections	Inhibit	33643278
Eosinophilic enteropathy	Associate	25234644
Epstein Barr Virus Infections	Stimulate	18246047
Erosive Adenomatosis of the Nipple	Associate	18489537
Esophageal Neoplasms	Associate	36226375, 37340770, 40587482
Esophageal Squamous Cell Carcinoma	Associate	32884895, 36288460, 36522683
Failure to Thrive	Associate	33358585
Familial cylindromatosis	Associate	32100077
Fatigue Syndrome Chronic	Stimulate	21619669
Fatigue Syndrome Chronic	Associate	23514202, 29867995
Fetal Growth Retardation	Associate	32973787
Fibrosis	Associate	21086571, 27243827, 32345003, 37002627
Food Hypersensitivity	Associate	22299310
Fusobacterium Infections	Stimulate	36960042
Gallbladder Neoplasms	Associate	34185421, 37828574
Gastritis	Associate	22228968, 31320834, 38366919
Gastritis	Inhibit	34755133
Gaucher Disease	Inhibit	27855396
Gaucher Disease	Associate	31775513
Genetic Diseases Inborn	Associate	38408297
Genetic Diseases X Linked	Associate	24792626
Germinoma	Stimulate	39958339
Giant Cell Arteritis	Associate	34583923
Gingivitis	Associate	34234776
Glioblastoma	Associate	16723631, 19028999, 24276989, 24570975, 24691423, 25555571, 29302887, 33429364, 35401877, 35757013
Glioma	Associate	17216339, 23108258, 33429364
Gliosarcoma	Associate	34876047, 35757013
Glomerulonephritis	Associate	24774748, 27225718
Glomerulonephritis Membranous	Associate	35479070
Glycogen Storage Disease Type II	Associate	28389590
Graft vs Host Disease	Inhibit	15172973, 23792271
Graft vs Host Disease	Associate	17478639, 19299332, 20302964, 22491736, 23818545, 24184334, 26473355, 28746369, 30027704, 36056390
Granuloma	Associate	32591586, 33720848
Granulomatosis with Polyangiitis	Associate	20113371, 31164680
Graves Disease	Associate	20942809, 24478186, 24784317, 29259988, 37904681
Graves Disease	Inhibit	23249428, 27206624
Graves Ophthalmopathy	Associate	25653477, 27349268
Graves Ophthalmopathy	Stimulate	32176314
Hamartoma Syndrome Multiple	Associate	27477328
Hashimoto Disease	Associate	20942809, 22666793, 24478186, 24784317, 25412700, 27478306, 28690889, 29527211, 32606302
Hashimoto Disease	Inhibit	23249428, 27206624
Heart Diseases	Associate	29473686
Heart Failure	Inhibit	21935395
Heart Failure	Associate	25984539
Helicobacter Infections	Associate	22228968
Helicobacter Infections	Stimulate	23299619
Hematologic Neoplasms	Associate	29850630
Hepatitis Autoimmune	Associate	26812071, 31422415
Hepatitis B	Stimulate	21489307
Hepatitis B	Associate	22489829, 23759077, 33506937, 36635631
Hepatitis B Chronic	Associate	21489307, 23759077
Hepatitis B Chronic	Stimulate	25323532
Hepatitis C	Associate	27243827
Hepatitis C Chronic	Associate	30233595
Hepatitis Chronic	Associate	31781109
Hereditary Breast and Ovarian Cancer Syndrome	Associate	30206415
Hereditary leiomyomatosis and renal cell cancer	Associate	18684866, 26722524
Histiocytosis Langerhans Cell	Associate	20220088, 22949932, 25031736, 32738155
HIV Infections	Associate	15252446, 15271794, 15937547, 16782163, 18613039, 20498045, 20520721, 21118300, 21653240, 22457280, 22471284, 23846566, 25198707, 26329520, 26501424, 27003495, 27384654, 31651258, 33974229, 34446704, 34748560, 35967314, 35967422, 36420277
HIV Infections	Stimulate	18821942, 33720848
HIV Infections	Inhibit	18829063, 22162758
HIV Seropositivity	Associate	29600938
Hodgkin Disease	Associate	19096012, 20065852, 21904560, 23045593, 26722524, 32513132
Hodgkin Disease	Stimulate	24942949
HTLV I Infections	Inhibit	18664281
HTLV I Infections	Associate	25148903, 29600938
Hydrops Fetalis	Associate	33637067, 35397126
Hyperglycemia	Stimulate	25894202
Hypertension Pregnancy Induced	Inhibit	29846432
Hypertension Pulmonary	Inhibit	31141166
Hypertrophy	Associate	30425273
Hypomagnesemia 5 Renal with Ocular Involvement	Associate	24774748
Hypothyroidism	Associate	18931102
Hypothyroidism	Stimulate	27478306
Hypoxia	Stimulate	24931519
Hypoxia	Associate	31287590, 34478955, 36157928
Hypoxia Brain	Stimulate	23723999, 24931519
Hypoxia Brain	Associate	37377902
Ichthyosis Lamellar	Associate	28317311
Idiopathic Pulmonary Fibrosis	Inhibit	20126467, 20646340
Idiopathic Pulmonary Fibrosis	Associate	34872285
Ige Responsiveness Atopic	Associate	25048800
Ileal Diseases	Associate	20722024
Immune Dysregulation Polyendocrinopathy Enteropathy X Linked Syndrome	Associate	11120765, 12296863, 14597756, 16371377, 16990602, 18489537, 18820676, 18931102, 19155519, 19738030, 20643476, 21400500, 21595732, 21865090, 22264504, 23223361, 23534974, 25326164, 28317311, 29193502, 29241729, 29400909, 29907148, 30443250, 31874182, 32494707, 33358585, 33546062, 33637067, 33864888, 34044499, 35479070, 36091011, 36152823, 36165514, 36600150, 36713411, 38117899
Immune Reconstitution Inflammatory Syndrome	Stimulate	22431997
Immune System Diseases	Associate	18931102, 30229436, 32988630, 34446704, 35967314
Immunoglobulin G4 Related Disease	Associate	18931102, 35479070
Immunoglobulin G4 Related Disease	Stimulate	26311608
Immunologic Deficiency Syndromes	Stimulate	28747257
Immunologic Deficiency Syndromes	Associate	34531853
Infections	Associate	18827929, 22647666, 26287606, 30027704, 30832593, 32785479, 39712011
Infections	Stimulate	33643278, 35967314
Inferior Wall Myocardial Infarction	Inhibit	23696918
Infertility	Associate	21481380, 22341374, 36603467
Infertility Male	Associate	31855573
Inflammation	Associate	17158635, 17302902, 17982032, 18330941, 18435801, 18510637, 18684844, 19250527, 19740339, 21147109, 21489307, 21926327, 22077067, 22228968, 22307621, 22736020, 22745276, 23322982, 23395819, 24301658, 25092890, 25096571, 25437819, 25762785, 26305224, 26830200, 27493106, 30389786, 30842769, 31440043, 32111105, 32388860, 32644293, 32867892, 32988630, 33800594, 33976194, 34160358, 34195300, 34626165, 34895167, 35780120, 35967422, 36717877, 37277792, 37782178, 38211712, 38366919, 40270290
Inflammation	Inhibit	19822525, 23121667, 34755133
Inflammation	Stimulate	31316519
Inflammatory Bowel Diseases	Associate	16045746, 18330941, 21376048, 22736020, 24792626, 26305224, 31664129, 32084423, 35905575
Inflammatory Breast Neoplasms	Associate	31145753, 35705026
Intestinal Diseases	Associate	22228968
Intestinal Polyposis	Associate	21091665
Iridogoniodysgenesis type1	Stimulate	34748560
Keratoacanthoma	Associate	29799076
Kidney Diseases	Associate	21494640, 28643491
Kidney Failure Chronic	Associate	40751815
Kidney Neoplasms	Associate	36751634
Latent Autoimmune Diabetes in Adults	Associate	27357431
Leiomyosarcoma	Associate	36786033
Leishmaniasis	Associate	25139022
Leishmaniasis Visceral	Associate	25200768
Leprosy	Associate	24214631, 25672298, 29883464, 34748560
Leprosy Lepromatous	Associate	24214631, 24454972
Leprosy Multibacillary	Associate	27764137
Leukemia	Associate	18510697, 18569641, 30468481, 31758697, 36706355
Leukemia	Stimulate	20801903
Leukemia Acute X Linked	Associate	22875869
Leukemia Lymphocytic Chronic B Cell	Associate	20081380, 21904560, 22101351
Leukemia Lymphoma Adult T Cell	Associate	15198736, 16108835, 17970785, 18246047, 18510697, 24041428, 29600938, 36997002
Leukemia Lymphoma Adult T Cell	Stimulate	22647666, 23962110
Leukemia Myelogenous Chronic BCR ABL Positive	Stimulate	31758697
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	34493241
Leukemia Myeloid Acute	Associate	23179394, 27016413, 29843224, 32802845, 33083479, 37928542
Leukemia Prolymphocytic T Cell	Stimulate	21985361
Lichen Planus Oral	Associate	34670484
Liver Cirrhosis	Stimulate	25323532
Liver Cirrhosis	Associate	28355233, 30233595
Liver Cirrhosis Biliary	Associate	17158635, 28146070, 33675743
Liver Cirrhosis Biliary	Inhibit	19302244
Liver Failure	Associate	36635631
Liver Failure Acute	Associate	29229400
Liver Neoplasms	Associate	30378283, 31653148
Lung Diseases	Associate	24292748, 29472922, 33589523
Lung Diseases Interstitial	Associate	24292748
Lung Injury	Associate	27310557
Lung Neoplasms	Associate	27692344, 28253320, 29436663, 33589523
Lung Neoplasms	Inhibit	28187172
Lupus Erythematosus Cutaneous	Inhibit	17530636
Lupus Erythematosus Systemic	Associate	16423064, 18311820, 18668553, 19155519, 19173720, 21708033, 22506043, 23125486, 25986394, 27156107, 27225718, 28542701, 29023682, 30009168, 31781109, 33329581, 33686190, 33746959, 34240405, 34940981, 35767890, 36107445, 36314527, 37782178
Lupus Erythematosus Systemic	Inhibit	17277168, 18052965, 18505426, 21496382, 24288552, 26079624, 32718891
Lupus Erythematosus Systemic	Stimulate	18800986, 23925905, 24774748, 28747257, 32317002
Lupus Nephritis	Associate	24475019, 24774748, 25339666, 27156107, 37368057
Lyme Disease	Associate	17177959
Lymphatic Diseases	Associate	23613769
Lymphatic Diseases	Stimulate	25669968
Lymphatic Metastasis	Associate	19604349, 21930068, 22569001, 23760912, 24040244, 26464616, 27457382, 28084319, 28923073, 31852159, 31930120, 32615729, 33062072, 40587482
Lymphatic Metastasis	Inhibit	28560891
Lymphatic Metastasis	Stimulate	36285512
Lymphoma	Stimulate	17615291
Lymphoma	Associate	18246047, 26464657, 26968188
Lymphoma B Cell	Associate	21463298, 22174855, 26464657
Lymphoma B Cell Marginal Zone	Associate	30219078, 32963045
Lymphoma Extranodal NK T Cell	Associate	26497849, 31653980
Lymphoma Follicular	Associate	21904560
Lymphoma Large B Cell Diffuse	Associate	18925695, 25425693, 26968188, 32079690, 36974470
Lymphoma Large B Cell Diffuse	Inhibit	26355571
Lymphoma Large Cell Anaplastic	Associate	18794055, 30206415
Lymphoma Non Hodgkin	Associate	17615291
Lymphoma Primary Cutaneous Anaplastic Large Cell	Associate	31640798
Lymphoma T Cell	Associate	16766651, 18794055, 30856039
Lymphoma T Cell Cutaneous	Associate	15514008, 18569641, 18684941, 19626037, 19674197, 26225678, 30718356
Lymphoma T Cell Peripheral	Associate	18794055
Lymphomatoid Granulomatosis	Associate	31640798
Lymphoproliferative Syndrome X Linked 2	Associate	17416586, 21595732, 21865090, 29193502, 35479070
Malaria	Associate	19877016
Melanoma	Stimulate	17574040
Melanoma	Associate	18414854, 18820132, 21547596, 23284620, 29620159, 31630873, 33117345, 34051744, 34112666, 35909944, 37197667
Melanoma Cutaneous Malignant	Associate	31630873, 34051744
Meningioma	Associate	25400783
Mesothelioma Malignant	Associate	19309551
Metabolic Diseases	Associate	30405296
Microsatellite Instability	Associate	18985040, 30377340, 30894409
Monoclonal Gammopathy of Undetermined Significance	Inhibit	16150935
Monoclonal Gammopathy of Undetermined Significance	Associate	21904560
Mouth Diseases	Associate	18330941, 25275597
Mucocutaneous Lymph Node Syndrome	Inhibit	20718783, 25039241, 37506144
Mucocutaneous Lymph Node Syndrome	Associate	22955109
Multiple Myeloma	Associate	16150935, 16410445, 21904560, 22666318, 23152910, 23232072, 25099367
Multiple Sclerosis	Associate	17944900, 18771523, 23039885, 24098530, 25938517, 26414764, 26714422, 27154631, 27424664, 29487369, 29527211, 30122421, 30229436, 30759186, 32988630, 33170805, 33329593, 34006899
Multiple Sclerosis	Inhibit	19016907, 21731726, 29295981
Multiple Sclerosis Relapsing Remitting	Inhibit	17897326
Multiple Sclerosis Relapsing Remitting	Stimulate	24098530
Multiple Sclerosis Relapsing Remitting	Associate	32988630
Muscular dystrophy congenital with central nervous system involvement	Associate	35767890
Muscular Dystrophy Duchenne	Associate	22496194
Myasthenia Gravis	Associate	23110942, 26347149, 26460311
Mycosis Fungoides	Inhibit	19674197
Mycosis Fungoides	Associate	24171863, 24610622, 26225678, 35642346
Myocardial Infarction	Associate	22426168
Myocarditis	Associate	21422001, 25144227, 35265721
Myositis Inclusion Body	Associate	24594700
Myotonic Dystrophy	Associate	21414848
Nasal Polyps	Associate	19250527, 38072196
Nasal Polyps	Inhibit	19639723
Nasopharyngeal Carcinoma	Associate	17262084, 19220831, 28871094, 31138162, 32564263, 32573058
Neoplasm Invasiveness	Stimulate	25669968
Neoplasm Invasiveness	Associate	27432879, 31852159, 34092607, 35681497
Neoplasm Metastasis	Associate	17433037, 22666793, 23760912, 26464616, 27045886, 29390966, 29620159, 32606302, 33062072, 34319010, 36522683, 36569924, 36650632, 38213053
Neoplasm Metastasis	Stimulate	25669968, 29929548
Neoplasm Metastasis	Inhibit	29089565
Neoplasms	Associate	16723631, 16757686, 16775224, 17216339, 17262084, 17414320, 17694575, 17970785, 18294387, 18414854, 18430198, 18569641, 18685848, 18794336, 18814264, 18820132, 18820666, 18923710, 19028999, 19220831, 19626037, 19674197, 19737943, 19808652, 20075077, 20096010, 20229175, 20234320, 20665489, 21048114, 21200385, 21251418, 21381020, 21649468, 21785264, 21904560, 21930068, 21935436, 22123319, 22143939, 22319577, 22431701, 22506556, 22555974, 22569001, 22585562, 22593175, 22666793, 22865105, 22879926, 22986453, 23169287, 23363815, 23382847, 23526963, 23529308, 23529839, 23681603, 23759077, 23760912, 23977174, 24022192, 24064667, 24127572, 24244610, 24276989, 24315995, 24338714, 24562936, 24675384, 24877082, 24885770, 24955518, 25193543, 25294906, 25400783, 25550807, 25555571, 25669968, 25779374, 25978381, 26161395, 26280204, 26317902, 26339391, 26355571, 26369701, 26437631, 26676638, 26823710, 26823784, 26851185, 26862849, 26885615, 26968188, 26979828, 27000869, 27045886, 27196573, 27278091, 27432879, 27457382, 27463005, 27473163, 27619682, 27669423, 27678454, 27777963, 27868139, 27892628, 28029650, 28084319, 28194445, 28239749, 28547958, 28560891, 28562349, 28602029, 28713192, 28831395, 29066497, 29089565, 29105795, 29236775, 29361059, 29390966, 29436663, 29615076, 29620159, 29730990, 30013992, 30027704, 30075815, 30221739, 30401949, 30474571, 30484986, 30572845, 30718356, 30978241, 31006654, 31134811, 31381571, 31549213, 31609157, 31616965, 31817155, 31852159, 31998307, 32066909, 32222891, 32324860, 32366528, 32513132, 32603557, 32681091, 32681436, 32761426, 32785290, 32802845, 32878426, 33045001, 33125511, 33162477, 33205061, 33269456, 33346915, 33555624, 33589523, 33875760, 33893830, 33994165, 34006632, 34051744, 34083572, 34092607, 34117905, 34191790, 34285260, 34319010, 34362334, 34365471, 34484468, 34502561, 34504204, 34531864, 34534729, 34539667, 34605709, 34626165, 34768829, 34907910, 34933280, 35173719, 35201851, 35219893, 35358193, 35443723, 35484226, 35705026, 35773332, 35909944, 36208136, 36288460, 36331328, 36550816, 36749873, 36870289, 36960042, 37022147, 37037284, 37072347, 37232845, 37543970, 37729362, 37914383, 37933083, 37970473, 38057799, 38167862, 38213053, 38376584, 39191079, 39409156, 39542103, 40088713, 40303346
Neoplasms	Inhibit	18441394, 21818290, 22152480, 24155921, 24338714, 29025424, 29549328, 29894486, 30011797, 30103821, 30378283, 35130925
Neoplasms	Stimulate	19079205, 19577568, 19673890, 20661468, 25225903, 27197067, 29391307
Neoplasms Adipose Tissue	Stimulate	25388403
Neoplasms Cystic Mucinous and Serous	Associate	19641607
Neoplasms Squamous Cell	Associate	20110382, 27683115
Nephritis	Associate	24774748, 33686190
Nephrotic Syndrome	Associate	18931102
Nephrotic Syndrome	Inhibit	30062391
Nervous System Diseases	Associate	26329520, 27016413
Neuroblastoma	Associate	26161395
Neutropenia	Associate	19344427
Nose Diseases	Associate	19639723, 21091665
Obesity	Associate	22228716, 38213254
Obesity	Stimulate	34382943
Oculocutaneous albinism type 2	Associate	21818290
Opportunistic Infections	Associate	32670274
Oropharyngeal Neoplasms	Associate	23686119
Osteoarthritis	Associate	27044824
Osteomyelitis	Associate	32954739
Ovarian Neoplasms	Stimulate	19673890, 36837407
Ovarian Neoplasms	Associate	23354626, 24244610, 26166762, 31537619, 34181334, 34502561, 35186171
Paget Disease Extramammary	Associate	22949100
Pancreatic Neoplasms	Associate	18430198, 23363422, 25669968, 26191284, 27589570, 33062072
Pancreatic Neoplasms	Inhibit	34933280
Pancreatitis Chronic	Associate	24797069
Papilloma	Associate	22322668, 35322929
Papillomavirus Infections	Associate	19808652, 22986453, 31177386
Paracoccidioidomycosis	Associate	25204704
Paralysis	Associate	33178221
Paraparesis Tropical Spastic	Inhibit	15864345, 18326816, 20945034
Paraparesis Tropical Spastic	Associate	19740339, 22647666, 24845974, 31340370
Paraparesis Tropical Spastic	Stimulate	24041428, 29600938
Parapsoriasis	Associate	26225678
Parkinson Disease	Associate	29621426
Parkinson Disease	Inhibit	40280259
Pemphigoid Benign Mucous Membrane	Associate	19350181
Pemphigoid Bullous	Inhibit	22310732
Pemphigus	Associate	36349750
Penile Neoplasms	Associate	25557886
Peptic Ulcer	Associate	22228968
Periapical Diseases	Associate	39972438
Periodontal Diseases	Associate	17355249
Periodontitis	Associate	30944162, 37277792
Peripheral Nervous System Diseases	Associate	36091011
Peritoneal Neoplasms	Associate	33269456
Persistent Mullerian duct syndrome	Associate	18794055
Personality Disorders	Associate	22666793
Pleural Effusion Malignant	Associate	29785404, 36567801
Pneumococcal Infections	Stimulate	30425273
Pneumonia	Associate	24292748
Polyendocrinopathies Autoimmune	Associate	17416586, 18931102, 21595732, 21865090, 23223361, 24792626, 25481456, 29193502, 29907148, 34044499, 35479070, 36152823
Polymyositis	Associate	29172719
Polyps	Associate	21091665
Pre Eclampsia	Associate	22809231, 22837649, 27999241, 28502089
Precancerous Conditions	Associate	38366919
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	30103821
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	30103821
Premature Birth	Inhibit	34195300
Primary Immunodeficiency Diseases	Associate	32265901, 32670274, 38644452
Primary Ovarian Insufficiency	Associate	33274669
Progressive hearing loss stapes fixation	Associate	29193502, 35130925
Prostatic Neoplasms	Associate	28547958, 28961847, 31549213, 35983819
Proteinuria	Associate	24774748, 35479070
Pseudoacromegaly with Severe Insulin Resistance	Associate	38408297
Psoriasis	Associate	28042206
Pulmonary Disease Chronic Obstructive	Inhibit	18684844, 23514217, 24805101, 31141166, 34079246, 35780120
Pulmonary Disease Chronic Obstructive	Associate	21651772, 22032685, 27310557, 30842769, 31308239, 31440043, 33317530, 34206428, 35687771
Pulmonary Edema	Associate	25010330
Pulpitis	Associate	33777260
Purpura Thrombocytopenic Idiopathic	Associate	20100010, 23215839, 24338252, 25485537, 31273052
Purpura Thrombocytopenic Idiopathic	Inhibit	37208911
Q Fever	Associate	22098165
Radicular Cyst	Associate	39972438
Recombinant chromosome 8 syndrome	Associate	35800157
Rectal Neoplasms	Associate	24997850
Recurrent respiratory papillomatosis	Associate	28298239
Renal Insufficiency Chronic	Associate	29619880
Respiratory Insufficiency	Associate	23514217
Retinal Dysplasia	Stimulate	32416752
Rheumatic Diseases	Associate	26076982
Rhinitis	Inhibit	23573194
Rhinitis Allergic	Associate	21091665, 22201619, 24460842
Root Resorption	Associate	32785479
Rufous oculocutaneous albinism	Associate	18820666
Sarcoidosis	Inhibit	18279440, 24882950
Sarcoidosis	Associate	38173720
Schizophrenia	Inhibit	32109548
Sepsis	Associate	35720398
Severe Acute Respiratory Syndrome	Inhibit	33253796
Severe Combined Immunodeficiency	Associate	32265901
Sezary Syndrome	Associate	19626037, 19901946, 26225678, 32409671
Sick Sinus Syndrome	Associate	23613769
Sjogren's Syndrome	Associate	29600938, 30632148
Sjogren's Syndrome	Inhibit	33228011
Skin Diseases	Associate	24335103, 34748560
Skin Diseases	Stimulate	24454972
Skin Manifestations	Associate	23432692
Skin Neoplasms	Associate	17970785
Sleep Apnea Obstructive	Associate	22077067, 32210181
Sleep Apnea Obstructive	Inhibit	32380702
Small Cell Lung Carcinoma	Associate	34006632
Spinal Cord Diseases	Associate	20945034
Splenomegaly	Associate	27188997
Spondylitis Ankylosing	Associate	16180249, 27901054
Squamous Cell Carcinoma of Head and Neck	Associate	18547033, 23977174, 24761979, 25779374, 27457382, 27841362, 30994705, 32304268, 32383556, 33010009, 33307825, 34319010, 34626165, 35664436, 36097539, 37210507, 38376584, 39695576
Squamous Intraepithelial Lesions	Associate	31177386, 40270290
Squamous Intraepithelial Lesions	Inhibit	34575971
Status Asthmaticus	Associate	23226205, 23395819, 28211345, 30013989, 33400919
Still's Disease Adult Onset	Inhibit	34319596
Stillbirth	Associate	32973787
Stomach Diseases	Associate	29025424
Stomach Neoplasms	Associate	21528082, 22228968, 22569001, 23723999, 24040244, 24460353, 26823784, 28743116, 29089565, 29391307, 30936882, 30988066, 31174544, 31631566, 31930120, 33575321, 33906525, 33978826, 34414959, 34968167, 35037550, 35443723, 37970473
Tachycardia Atrioventricular Nodal Reentry	Associate	26339391
Takayasu Arteritis	Associate	35126357
Tarlov Cysts	Inhibit	36433731
Tertiary Lymphoid Structures	Inhibit	18684941
Tertiary Lymphoid Structures	Associate	26823710, 29390966, 32681436, 32963045
Tertiary Lymphoid Structures	Stimulate	32606302
Thrombosis	Associate	21251418, 23759077
Thymoma	Associate	26460311, 33592902, 33819365
Thyroid Cancer Papillary	Associate	26264613, 32606302, 36518249, 37563607
Thyroid Diseases	Associate	23249428
Thyroid Neoplasms	Associate	22666793, 27045886, 27892628, 30005868, 36203616
Thyroiditis	Associate	24478186
Thyroiditis Autoimmune	Associate	19141582, 20942809, 24478186, 24784317, 25481456, 36518249
Thyroiditis Autoimmune	Inhibit	23249428, 27206624
Thyroiditis Chronic	Associate	27086659
Tourette Syndrome	Associate	26709833
Trachoma	Associate	16881731
Triple Negative Breast Neoplasms	Associate	24877082, 28713192, 28984302, 32622323, 32681436, 34362334, 38308298, 39986022
Tuberculosis	Stimulate	21303360, 25198707, 29489879
Tuberculosis	Associate	22431997, 25510482
Tuberculosis	Inhibit	22438899
Tuberculosis Meningeal	Associate	23826366
Tuberculosis Meningeal	Stimulate	29996789
Tuberculosis Multidrug Resistant	Associate	20655262
Tuberculosis Pulmonary	Associate	23578109, 25510482, 28881482, 29472922, 29489879
Turcot syndrome	Associate	26496037, 39207001
Turner Syndrome	Associate	19150256, 26709833
Urinary Bladder Neoplasms	Associate	26862849, 26927070, 35227680, 35314433, 36870289
Urinary Bladder Neoplasms	Stimulate	34539008
Uterine Cervical Diseases	Stimulate	19079205
Uterine Cervical Dysplasia	Stimulate	19079205, 19089920
Uterine Cervical Dysplasia	Associate	22986453, 34739585, 36792811
Uterine Cervical Neoplasms	Associate	17433037, 19808652, 21930068, 22986453, 23760912, 26464616, 28923073, 29229929, 30474571, 31177386, 33880574, 34674573, 35322929, 38084896, 39346086
Uterine Cervical Neoplasms	Stimulate	23587428
Uterine Cervicitis	Associate	29718856, 31177386
Uveal melanoma	Associate	20209608, 33203661, 36466923
Vascular Diseases	Associate	38213254
Vasculitis	Inhibit	34950150
Vasculitis Leukocytoclastic Cutaneous	Associate	20110382
Vipoma	Associate	33358585
Viremia	Associate	18620494
Virus Diseases	Associate	22489829, 28298239, 30233595, 33213373, 33643278
Virus Diseases	Stimulate	27243827
Vitamin D Deficiency	Stimulate	25510482
Vitiligo	Associate	20175879, 25479423
Vitiligo	Inhibit	33200798, 40723924
Vulvar Lichen Sclerosus	Inhibit	33438816
Wounds and Injuries	Associate	18510637, 22745276