Gene Gene information from NCBI Gene database.
Entrez ID 5094
Gene name Poly(rC) binding protein 2
Gene symbol PCBP2
Synonyms (NCBI Gene)
HNRNPE2HNRPE2hnRNP-E2
Chromosome 12
Chromosome location 12q13.13
Summary The protein encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Tog
miRNA miRNA information provided by mirtarbase database.
601
miRTarBase ID miRNA Experiments Reference
MIRT052216 hsa-let-7b-5p CLASH 23622248
MIRT051448 hsa-let-7e-5p CLASH 23622248
MIRT049623 hsa-miR-92a-3p CLASH 23622248
MIRT048457 hsa-miR-100-5p CLASH 23622248
MIRT046688 hsa-miR-222-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
42
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0003676 Function Nucleic acid binding IEA
GO:0003677 Function DNA binding IEA
GO:0003697 Function Single-stranded DNA binding IBA
GO:0003723 Function RNA binding HDA 22658674, 22681889
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601210 8648 ENSG00000197111
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15366
Protein name Poly(rC)-binding protein 2 (Alpha-CP2) (Heterogeneous nuclear ribonucleoprotein E2) (hnRNP E2)
Protein function Single-stranded nucleic acid binding protein that binds preferentially to oligo dC (PubMed:12414943, PubMed:7607214). Major cellular poly(rC)-binding protein (PubMed:12414943). Also binds poly(rU) (PubMed:12414943). Acts as a negative regulator
PDB 2AXY , 2JZX , 2P2R , 2PQU , 2PY9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00013 KH_1 15 77 KH domain Domain
PF00013 KH_1 99 163 KH domain Domain
PF00013 KH_1 289 353 KH domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in all tissues examined. {ECO:0000269|PubMed:7607214}.
Sequence
MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIIT
LAGPTNAIFKAFAMIID
KLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKI
KEIRESTGAQVQVAGDMLPNSTERAITIAGIPQSIIECVKQIC
VVMLETLSQSPPKGVTI
PYRPKPSSSPVIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQ
PDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWGLDASAQTTSHELTIPNDLIG
CIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYLINV
RLSSETG
GMGSS
Sequence length 365
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Ferroptosis   mRNA Splicing - Major Pathway
Processing of Capped Intron-Containing Pre-mRNA
Negative regulators of DDX58/IFIH1 signaling
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
GOUT GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
TESTICULAR HYDROCELE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Amyotrophic Lateral Sclerosis Inhibit 33313661
★☆☆☆☆
Found in Text Mining only
Amyotrophic lateral sclerosis 1 Associate 33313661
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Associate 28263985
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Associate 28443473
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Associate 29742422
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Stimulate 28443473
★☆☆☆☆
Found in Text Mining only
Cell Transformation Neoplastic Associate 32802869
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Associate 32373956, 32802869
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Type 1 Associate 32284404
★☆☆☆☆
Found in Text Mining only
Frontotemporal Dementia Associate 28666471
★☆☆☆☆
Found in Text Mining only