Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5093
Gene name	Poly(rC) binding protein 1
Gene symbol	PCBP1
Synonyms (NCBI Gene)	HEL-S-85HNRPE1HNRPXhnRNP-E1hnRNP-X
Chromosome	2
Chromosome location	2p13.3
Summary	This intronless gene is thought to have been generated by retrotransposition of a fully processed PCBP-2 mRNA. This gene and PCBP-2 have paralogues (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. The p

312

Show/Hide all (312)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004814	hsa-miR-21-5p	Quantitative proteomic approach	19253296
MIRT004814	hsa-miR-21-5p	Luciferase reporter assay	22316494
MIRT004814	hsa-miR-21-5p	Luciferase reporter assay	22316494
MIRT004814	hsa-miR-21-5p	Luciferase reporter assay	22316494
MIRT004814	hsa-miR-21-5p	Luciferase reporter assay	22316494
MIRT004814	hsa-miR-21-5p	Luciferase reporter assay	22316494
MIRT004814	hsa-miR-21-5p	Luciferase reporter assay	22316494
MIRT048509	hsa-miR-100-5p	CLASH	23622248
MIRT038098	hsa-miR-423-5p	CLASH	23622248
MIRT036126	hsa-miR-1296-5p	CLASH	23622248
MIRT035937	hsa-miR-1180-3p	CLASH	23622248
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT492810	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT089341	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT089340	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT492810	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT089341	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT492809	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT089349	hsa-miR-7846-3p	PAR-CLIP	20371350
MIRT089340	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT492808	hsa-miR-4321	PAR-CLIP	20371350
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT492810	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT089341	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT492809	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT089349	hsa-miR-7846-3p	PAR-CLIP	20371350
MIRT089340	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT492808	hsa-miR-4321	PAR-CLIP	20371350
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT492810	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT089341	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT492809	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT089349	hsa-miR-7846-3p	PAR-CLIP	20371350
MIRT089340	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT492808	hsa-miR-4321	PAR-CLIP	20371350
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	23446348
MIRT492810	hsa-miR-561-3p	PAR-CLIP	23446348
MIRT089341	hsa-miR-382-5p	PAR-CLIP	23446348
MIRT492809	hsa-miR-4724-5p	PAR-CLIP	23446348
MIRT089349	hsa-miR-7846-3p	PAR-CLIP	23446348
MIRT089340	hsa-miR-142-5p	PAR-CLIP	23446348
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	23446348
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	23446348
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	23446348
MIRT492808	hsa-miR-4321	PAR-CLIP	23446348
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	23592263
MIRT492810	hsa-miR-561-3p	PAR-CLIP	23592263
MIRT089339	hsa-miR-10a-3p	PAR-CLIP	23592263
MIRT089341	hsa-miR-382-5p	PAR-CLIP	23592263
MIRT492809	hsa-miR-4724-5p	PAR-CLIP	23592263
MIRT089349	hsa-miR-7846-3p	PAR-CLIP	23592263
MIRT089340	hsa-miR-142-5p	PAR-CLIP	23592263
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	23592263
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	23592263
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	23592263
MIRT492808	hsa-miR-4321	PAR-CLIP	23592263
MIRT236806	hsa-miR-3936	PAR-CLIP	23592263
MIRT353816	hsa-miR-6768-5p	PAR-CLIP	23592263
MIRT236807	hsa-miR-4773	PAR-CLIP	23592263
MIRT353812	hsa-miR-2681-3p	PAR-CLIP	23592263
MIRT303380	hsa-miR-6871-5p	PAR-CLIP	23592263
MIRT471529	hsa-miR-4461	PAR-CLIP	23592263
MIRT236805	hsa-miR-922	PAR-CLIP	23592263
MIRT236808	hsa-miR-5681a	PAR-CLIP	23592263
MIRT303381	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT471528	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT471527	hsa-miR-8085	PAR-CLIP	23592263
MIRT471526	hsa-miR-3941	PAR-CLIP	23592263
MIRT353814	hsa-miR-4672	PAR-CLIP	23592263
MIRT471525	hsa-miR-466	PAR-CLIP	23592263
MIRT303378	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT303377	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT303379	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT004814	hsa-miR-21-5p	Microarray	32170623
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT492810	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT089341	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT089340	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT492810	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT089341	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT492809	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT089349	hsa-miR-7846-3p	PAR-CLIP	20371350
MIRT089340	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT492808	hsa-miR-4321	PAR-CLIP	20371350
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT492810	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT089341	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT492809	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT089349	hsa-miR-7846-3p	PAR-CLIP	20371350
MIRT089340	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT492808	hsa-miR-4321	PAR-CLIP	20371350
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT492810	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT089341	hsa-miR-382-5p	PAR-CLIP	20371350
MIRT492809	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT089349	hsa-miR-7846-3p	PAR-CLIP	20371350
MIRT089340	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	20371350
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT492808	hsa-miR-4321	PAR-CLIP	20371350
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	23446348
MIRT492810	hsa-miR-561-3p	PAR-CLIP	23446348
MIRT089341	hsa-miR-382-5p	PAR-CLIP	23446348
MIRT492809	hsa-miR-4724-5p	PAR-CLIP	23446348
MIRT089349	hsa-miR-7846-3p	PAR-CLIP	23446348
MIRT089340	hsa-miR-142-5p	PAR-CLIP	23446348
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	23446348
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	23446348
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	23446348
MIRT492808	hsa-miR-4321	PAR-CLIP	23446348
MIRT492811	hsa-miR-548at-5p	PAR-CLIP	23592263
MIRT492810	hsa-miR-561-3p	PAR-CLIP	23592263
MIRT089339	hsa-miR-10a-3p	PAR-CLIP	23592263
MIRT089341	hsa-miR-382-5p	PAR-CLIP	23592263
MIRT492809	hsa-miR-4724-5p	PAR-CLIP	23592263
MIRT089349	hsa-miR-7846-3p	PAR-CLIP	23592263
MIRT089340	hsa-miR-142-5p	PAR-CLIP	23592263
MIRT089347	hsa-miR-5590-3p	PAR-CLIP	23592263
MIRT353817	hsa-miR-4738-3p	PAR-CLIP	23592263
MIRT089345	hsa-miR-3682-3p	PAR-CLIP	23592263
MIRT492808	hsa-miR-4321	PAR-CLIP	23592263
MIRT236806	hsa-miR-3936	PAR-CLIP	23592263
MIRT353816	hsa-miR-6768-5p	PAR-CLIP	23592263
MIRT236807	hsa-miR-4773	PAR-CLIP	23592263
MIRT353812	hsa-miR-2681-3p	PAR-CLIP	23592263
MIRT303380	hsa-miR-6871-5p	PAR-CLIP	23592263
MIRT471529	hsa-miR-4461	PAR-CLIP	23592263
MIRT236805	hsa-miR-922	PAR-CLIP	23592263
MIRT236808	hsa-miR-5681a	PAR-CLIP	23592263
MIRT303381	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT471528	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT471527	hsa-miR-8085	PAR-CLIP	23592263
MIRT471526	hsa-miR-3941	PAR-CLIP	23592263
MIRT353814	hsa-miR-4672	PAR-CLIP	23592263
MIRT471525	hsa-miR-466	PAR-CLIP	23592263
MIRT303378	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT303377	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT303379	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT1216374	hsa-miR-1246	CLIP-seq
MIRT1216375	hsa-miR-1305	CLIP-seq
MIRT1216376	hsa-miR-1323	CLIP-seq
MIRT1216377	hsa-miR-1468	CLIP-seq
MIRT1216378	hsa-miR-21	CLIP-seq
MIRT1216379	hsa-miR-2681	CLIP-seq
MIRT1216380	hsa-miR-3120-3p	CLIP-seq
MIRT1216381	hsa-miR-3123	CLIP-seq
MIRT1216382	hsa-miR-3126-5p	CLIP-seq
MIRT1216383	hsa-miR-3143	CLIP-seq
MIRT1216384	hsa-miR-3163	CLIP-seq
MIRT1216385	hsa-miR-323-3p	CLIP-seq
MIRT1216386	hsa-miR-338-3p	CLIP-seq
MIRT1216387	hsa-miR-340	CLIP-seq
MIRT1216388	hsa-miR-34b	CLIP-seq
MIRT1216389	hsa-miR-3613-3p	CLIP-seq
MIRT1216390	hsa-miR-3617	CLIP-seq
MIRT1216391	hsa-miR-3671	CLIP-seq
MIRT1216392	hsa-miR-382	CLIP-seq
MIRT1216393	hsa-miR-3919	CLIP-seq
MIRT1216394	hsa-miR-4282	CLIP-seq
MIRT1216395	hsa-miR-4310	CLIP-seq
MIRT1216396	hsa-miR-433	CLIP-seq
MIRT1216397	hsa-miR-4419a	CLIP-seq
MIRT1216398	hsa-miR-4420	CLIP-seq
MIRT1216399	hsa-miR-4436b-5p	CLIP-seq
MIRT1216400	hsa-miR-4477a	CLIP-seq
MIRT1216401	hsa-miR-4510	CLIP-seq
MIRT1216402	hsa-miR-4517	CLIP-seq
MIRT1216403	hsa-miR-4668-5p	CLIP-seq
MIRT1216404	hsa-miR-4760-3p	CLIP-seq
MIRT1216405	hsa-miR-489	CLIP-seq
MIRT1216406	hsa-miR-526b	CLIP-seq
MIRT1216407	hsa-miR-543	CLIP-seq
MIRT1216408	hsa-miR-548a-3p	CLIP-seq
MIRT1216409	hsa-miR-548aa	CLIP-seq
MIRT1216410	hsa-miR-548ac	CLIP-seq
MIRT1216411	hsa-miR-548ae	CLIP-seq
MIRT1216412	hsa-miR-548aj	CLIP-seq
MIRT1216413	hsa-miR-548am	CLIP-seq
MIRT1216414	hsa-miR-548d-3p	CLIP-seq
MIRT1216415	hsa-miR-548e	CLIP-seq
MIRT1216416	hsa-miR-548f	CLIP-seq
MIRT1216417	hsa-miR-548g	CLIP-seq
MIRT1216418	hsa-miR-548o	CLIP-seq
MIRT1216419	hsa-miR-548x	CLIP-seq
MIRT1216420	hsa-miR-548z	CLIP-seq
MIRT1216421	hsa-miR-561	CLIP-seq
MIRT1216422	hsa-miR-590-5p	CLIP-seq
MIRT1216423	hsa-miR-600	CLIP-seq
MIRT1216424	hsa-miR-607	CLIP-seq
MIRT1216425	hsa-miR-619	CLIP-seq
MIRT1216426	hsa-miR-641	CLIP-seq
MIRT1216374	hsa-miR-1246	CLIP-seq
MIRT1216379	hsa-miR-2681	CLIP-seq
MIRT1216381	hsa-miR-3123	CLIP-seq
MIRT1216386	hsa-miR-338-3p	CLIP-seq
MIRT1216388	hsa-miR-34b	CLIP-seq
MIRT1216393	hsa-miR-3919	CLIP-seq
MIRT1216395	hsa-miR-4310	CLIP-seq
MIRT1216398	hsa-miR-4420	CLIP-seq
MIRT1216374	hsa-miR-1246	CLIP-seq
MIRT1216377	hsa-miR-1468	CLIP-seq
MIRT1216379	hsa-miR-2681	CLIP-seq
MIRT1216381	hsa-miR-3123	CLIP-seq
MIRT1216382	hsa-miR-3126-5p	CLIP-seq
MIRT1216386	hsa-miR-338-3p	CLIP-seq
MIRT1216388	hsa-miR-34b	CLIP-seq
MIRT1216392	hsa-miR-382	CLIP-seq
MIRT1216393	hsa-miR-3919	CLIP-seq
MIRT1216395	hsa-miR-4310	CLIP-seq
MIRT1216397	hsa-miR-4419a	CLIP-seq
MIRT1216398	hsa-miR-4420	CLIP-seq
MIRT1216399	hsa-miR-4436b-5p	CLIP-seq
MIRT1216401	hsa-miR-4510	CLIP-seq
MIRT1216405	hsa-miR-489	CLIP-seq
MIRT2062517	hsa-miR-520d-5p	CLIP-seq
MIRT2062518	hsa-miR-524-5p	CLIP-seq
MIRT1216406	hsa-miR-526b	CLIP-seq
MIRT1216407	hsa-miR-543	CLIP-seq
MIRT1216409	hsa-miR-548aa	CLIP-seq
MIRT1216421	hsa-miR-561	CLIP-seq
MIRT1216423	hsa-miR-600	CLIP-seq
MIRT1216425	hsa-miR-619	CLIP-seq
MIRT2062519	hsa-miR-944	CLIP-seq
MIRT1216374	hsa-miR-1246	CLIP-seq
MIRT1216378	hsa-miR-21	CLIP-seq
MIRT1216379	hsa-miR-2681	CLIP-seq
MIRT1216381	hsa-miR-3123	CLIP-seq
MIRT1216382	hsa-miR-3126-5p	CLIP-seq
MIRT1216384	hsa-miR-3163	CLIP-seq
MIRT1216386	hsa-miR-338-3p	CLIP-seq
MIRT1216387	hsa-miR-340	CLIP-seq
MIRT1216388	hsa-miR-34b	CLIP-seq
MIRT1216392	hsa-miR-382	CLIP-seq
MIRT1216393	hsa-miR-3919	CLIP-seq
MIRT1216395	hsa-miR-4310	CLIP-seq
MIRT1216397	hsa-miR-4419a	CLIP-seq
MIRT1216398	hsa-miR-4420	CLIP-seq
MIRT1216401	hsa-miR-4510	CLIP-seq
MIRT1216403	hsa-miR-4668-5p	CLIP-seq
MIRT2062517	hsa-miR-520d-5p	CLIP-seq
MIRT2062518	hsa-miR-524-5p	CLIP-seq
MIRT1216408	hsa-miR-548a-3p	CLIP-seq
MIRT1216409	hsa-miR-548aa	CLIP-seq
MIRT1216410	hsa-miR-548ac	CLIP-seq
MIRT1216411	hsa-miR-548ae	CLIP-seq
MIRT1216412	hsa-miR-548aj	CLIP-seq
MIRT1216413	hsa-miR-548am	CLIP-seq
MIRT1216414	hsa-miR-548d-3p	CLIP-seq
MIRT1216415	hsa-miR-548e	CLIP-seq
MIRT1216416	hsa-miR-548f	CLIP-seq
MIRT1216419	hsa-miR-548x	CLIP-seq
MIRT1216420	hsa-miR-548z	CLIP-seq
MIRT1216421	hsa-miR-561	CLIP-seq
MIRT1216422	hsa-miR-590-5p	CLIP-seq
MIRT1216425	hsa-miR-619	CLIP-seq
MIRT2062519	hsa-miR-944	CLIP-seq
MIRT1216374	hsa-miR-1246	CLIP-seq
MIRT1216378	hsa-miR-21	CLIP-seq
MIRT1216381	hsa-miR-3123	CLIP-seq
MIRT1216384	hsa-miR-3163	CLIP-seq
MIRT1216386	hsa-miR-338-3p	CLIP-seq
MIRT1216387	hsa-miR-340	CLIP-seq
MIRT1216393	hsa-miR-3919	CLIP-seq
MIRT1216395	hsa-miR-4310	CLIP-seq
MIRT1216408	hsa-miR-548a-3p	CLIP-seq
MIRT1216415	hsa-miR-548e	CLIP-seq
MIRT1216416	hsa-miR-548f	CLIP-seq
MIRT1216422	hsa-miR-590-5p	CLIP-seq
MIRT2062519	hsa-miR-944	CLIP-seq
MIRT1216384	hsa-miR-3163	CLIP-seq
MIRT1216423	hsa-miR-600	CLIP-seq
MIRT1216379	hsa-miR-2681	CLIP-seq
MIRT1216379	hsa-miR-2681	CLIP-seq
MIRT1216382	hsa-miR-3126-5p	CLIP-seq
MIRT1216385	hsa-miR-323-3p	CLIP-seq
MIRT1216397	hsa-miR-4419a	CLIP-seq
MIRT1216400	hsa-miR-4477a	CLIP-seq
MIRT1216401	hsa-miR-4510	CLIP-seq
MIRT2062517	hsa-miR-520d-5p	CLIP-seq
MIRT2062518	hsa-miR-524-5p	CLIP-seq
MIRT1216409	hsa-miR-548aa	CLIP-seq
MIRT1216417	hsa-miR-548g	CLIP-seq
MIRT1216425	hsa-miR-619	CLIP-seq
MIRT2062519	hsa-miR-944	CLIP-seq
MIRT1216379	hsa-miR-2681	CLIP-seq
MIRT1216382	hsa-miR-3126-5p	CLIP-seq
MIRT1216397	hsa-miR-4419a	CLIP-seq
MIRT1216401	hsa-miR-4510	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003697	Function	Single-stranded DNA binding	IBA
GO:0003697	Function	Single-stranded DNA binding	IDA	8152927
GO:0003697	Function	Single-stranded DNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IDA	7556077, 7607214, 8152927
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IBA
GO:0003729	Function	MRNA binding	IDA	14722620
GO:0005515	Function	Protein binding	IPI	16713569, 17389360, 20374249, 21994455, 22028648, 22365833, 22673507, 25416956, 28169274, 31515488, 32296183, 35271311, 39251607
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	25468996
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016607	Component	Nuclear speck	IDA
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA
GO:0039694	Process	Viral RNA genome replication	IDA	12414943
GO:0039694	Process	Viral RNA genome replication	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0098847	Function	Sequence-specific single stranded DNA binding	IEA
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
601209	8647	ENSG00000169564

Q15365

Protein name

Poly(rC)-binding protein 1 (Alpha-CP1) (Heterogeneous nuclear ribonucleoprotein E1) (hnRNP E1) (Nucleic acid-binding protein SUB2.3)

Protein function

Single-stranded nucleic acid binding protein that binds preferentially to oligo dC (PubMed:15731341, PubMed:7556077, PubMed:7607214, PubMed:8152927). Together with PCBP2, required for erythropoiesis, possibly by regulating mRNA splicing (By simi

PDB

1WVN , 1ZTG , 3VKE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00013	KH_1	15 → 77	KH domain	Domain
PF00013	KH_1	99 → 164	KH domain	Domain
PF00013	KH_1	281 → 345	KH domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Abundantly expressed in skeletal muscle, thymus and peripheral blood leukocytes while a lower expression is observed in prostate, spleen, testis, ovary, small intestine, heart, liver, adrenal and thyroid glands. {ECO:0000269|PubMed:760

Sequence

MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIIT
LTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCGSLIGKGGCKI
KEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMT
IPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQ
VARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQTTHELTIPNNLIGCIIGRQGA
NINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARLSSEKGMGCS

Sequence length

356

Interactions

View interactions

	KEGG		Reactome
	Spliceosome Ferroptosis Cytosolic DNA-sensing pathway		mRNA Splicing - Major Pathway Processing of Capped Intron-Containing Pre-mRNA

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (48)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Inhibit	35600050, 35907982	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	37256932	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Associate	38013317	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Stimulate	15514164	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Inhibit	31223278	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Associate	37927213	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Calcinosis Cutis	Inhibit	27067543	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	21654215	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Inhibit	35907982	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Inhibit	20361869	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	34857818	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Inhibit	26261610	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Stimulate	15514164	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Associate	15514164	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	15514164	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	28076324	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Associate	26802051	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Associate	38013317	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Stimulate	35287546	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	35287546	★★★★★ ★☆☆☆☆ Found in Text Mining only
Folate Malabsorption Hereditary	Associate	21930702	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Disease	Inhibit	22801034	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	30984540	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucosephosphate Dehydrogenase Deficiency	Associate	35287546	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Associate	22801034	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infections	Inhibit	21752917	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Inhibit	26293996	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	24819169	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Inhibit	35907982	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Associate	22260379	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	21654215, 27067543, 34857818, 35100974, 35896897	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	12890803, 20361869, 21654215, 25265318, 25661993, 26802051, 27067543, 29622466, 31138119, 31223278, 32523987	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	27629145, 34857818, 35896897, 35907982, 37927213	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus	Inhibit	22801034	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	25265318	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Inhibit	29138420	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Associate	35909514	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	25661993, 27629145	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Associate	29622466	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Inhibit	31223278	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Intraepithelial Lesions	Associate	12890803	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Inhibit	29138420	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	35100974, 37303491	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	28963376	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Associate	12890803	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	12890803, 35896897	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervicitis	Associate	12890803	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Associate	31223288	★★★★★ ★☆☆☆☆ Found in Text Mining only

PCBP1 (poly(rC) binding protein 1)