Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5089
Gene name Gene Name - the full gene name approved by the HGNC.
PBX homeobox 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PBX2
Synonyms (NCBI Gene) Gene synonyms aliases
G17, HOX12, PBX2MHC
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a ubiquitously expressed member of the TALE/PBX homeobox family. It was identified by its similarity to a homeobox gene which is involved in t(1;19) translocation in acute pre-B-cell leukemias. This protein is a transcriptional activator
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT049093 hsa-miR-92a-3p CLASH 23622248
MIRT048088 hsa-miR-197-3p CLASH 23622248
MIRT046804 hsa-miR-222-3p CLASH 23622248
MIRT045365 hsa-miR-185-5p CLASH 23622248
MIRT043641 hsa-miR-326 CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 12054735
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IDA 19356220
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
176311 8633 ENSG00000204304
Protein
UniProt ID P40425
Protein name Pre-B-cell leukemia transcription factor 2 (Homeobox protein PBX2) (Protein G17)
Protein function Transcriptional activator that binds the sequence 5'-ATCAATCAA-3'. Activates transcription of PF4 in complex with MEIS1.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03792 PBC 50 243 PBC domain Family
PF00046 Homeodomain 245 304 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed.
Sequence
MDERLLGPPPPGGGRGGLGLVSGEPGGPGEPPGGGDPGGGSGGVPGGRGKQDIGDILQQI
MTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRSSQEEEPVDPQLMRLDN
MLLAEGVAGPEKGGGSAAAAAAAAASGGGVSPDNSIEHSDYRSKLAQIRHIYHSELEKYE
QACNEFTTHVMNLLREQSRTRPVAPKEMERMVSIIHRKFSAIQMQLKQSTCEAVMILRSR
FLD
ARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRI
RYKK
NIGKFQEEANIYAVKTAVSVTQGGHSRTSSPTPPSSAGSGGSFNLSGSGDMFLGMP
GLNGDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSWQEAVTPSSVTSPTEG
PGSVHSDTSN
Sequence length 430
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Anxiety Disorder Anxiety N/A N/A GWAS
Asthma Asthma N/A N/A GWAS
Cervical Cancer Cervical cancer N/A N/A GWAS
Coronary artery disease Coronary artery disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Anxiety Associate 36814110
Breast Neoplasms Associate 32497068, 37445737
Carcinoma Non Small Cell Lung Associate 19356220
Carcinoma Squamous Cell Associate 22374608
Celiac Disease Associate 36814110
Inflammation Associate 21760952
Leukemia Myeloid Acute Associate 22964640
Melanoma Associate 23400877
Migraine Disorders Associate 36814110
Neoplasms Associate 20150185