SPOCK3 (SPARC (osteonectin), cwcv and kazal like domains proteoglycan 3)

Gene

• Entrez ID: 50859
• Gene name: SPARC (osteonectin), cwcv and kazal like domains proteoglycan 3
• Gene symbol: SPOCK3
• Synonyms (NCBI Gene): HSAJ1454, TES-3, TICN3
• Chromosome: 4
• Chromosome location: 4q32.3
• Summary: This gene encodes a member of a novel family of calcium-binding proteoglycan proteins that contain thyroglobulin type-1 and Kazal-like domains. The encoded protein and may play a role in adult T-cell leukemia by inhibiting the activity of membrane-type ma

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1385131	hsa-miR-3685	CLIP-seq
MIRT1385132	hsa-miR-384	CLIP-seq
MIRT1385133	hsa-miR-448	CLIP-seq
MIRT1385134	hsa-miR-500a	CLIP-seq
MIRT1385135	hsa-miR-605	CLIP-seq
MIRT1385136	hsa-miR-452	CLIP-seq
MIRT1385137	hsa-miR-4676-3p	CLIP-seq
MIRT1385138	hsa-miR-219-2-3p	CLIP-seq
MIRT1385139	hsa-miR-2964a-3p	CLIP-seq
MIRT1385140	hsa-miR-3153	CLIP-seq
MIRT1385141	hsa-miR-4646-5p	CLIP-seq
MIRT1385142	hsa-miR-4668-5p	CLIP-seq
MIRT1385143	hsa-miR-568	CLIP-seq
MIRT2631529	hsa-miR-4280	CLIP-seq
MIRT1385136	hsa-miR-452	CLIP-seq
MIRT1385137	hsa-miR-4676-3p	CLIP-seq
MIRT2631529	hsa-miR-4280	CLIP-seq
MIRT1385136	hsa-miR-452	CLIP-seq
MIRT1385137	hsa-miR-4676-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004857	Function	Enzyme inhibitor activity	IEA
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005518	Function	Collagen binding	IBA
GO:0005539	Function	Glycosaminoglycan binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	11751414
GO:0008191	Function	Metalloendopeptidase inhibitor activity	IDA	11751414
GO:0008191	Function	Metalloendopeptidase inhibitor activity	IEA
GO:0008191	Function	Metalloendopeptidase inhibitor activity	TAS	12810672
GO:0010951	Process	Negative regulation of endopeptidase activity	IDA	11751414
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0031012	Component	Extracellular matrix	HDA	32055794
GO:0031012	Component	Extracellular matrix	HDA	33266304
GO:0031012	Component	Extracellular matrix	IDA	11751414
GO:0050840	Function	Extracellular matrix binding	IBA
GO:2000146	Process	Negative regulation of cell motility	TAS	12810672

Other IDs

• MIM: 607989
• HGNC: 13565
• e!Ensembl: ENSG00000196104

Protein

• UniProt ID: Q9BQ16
• Protein name: Testican-3 (SPARC/osteonectin, CWCV, and Kazal-like domains proteoglycan 3)
• Protein function: May participate in diverse steps of neurogenesis. Inhibits the processing of pro-matrix metalloproteinase 2 (MMP-2) by MT1-MMP and MT3-MMP. May interfere with tumor invasion.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07648	Kazal_2	137 → 183	Kazal-type serine protease inhibitor domain	Domain
  PF10591	SPARC_Ca_bdg	198 → 308	Secreted protein acidic and rich in cysteine Ca binding region	Domain
  PF00086	Thyroglobulin_1	317 → 380	Thyroglobulin type-1 repeat	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain.
• Sequence:

  MLKVSAVLCVCAAAWCSQSLAAAAAVAAAGGRSDGGNFLDDKQWLTTISQYDKEVGQWNK
  FRDEVEDDYFRTWSPGKPFDQALDPAKDPCLKMKCSRHKVCIAQDSQTAVCISHRRLTHR
  MKEAGVDHRQWRGPILSTCKQCPVVYPSPVCGSDGHTYSFQCKLEYQACVLGKQISVKCE
  GHCPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKTLLRPERSR
  FDTSILPICKDSLGWMFNRLDTNYDLLLDQSELRSIYLDKNEQCTKAFFNSCDTYKDSLI
  SNNEWCYCFQRQQDPPCQTELSNIQKRQGVKKLLGQYIPLCDEDGYYKPTQCHGSVGQCW
  CVDRYGNEVMGSRINGVADCAIDFEISGDFASGDFHEWTDDEDDEDDIMNDEDEIEDDDE
  DEGDDDDGGDDHDVYI

• Sequence length: 436

Pathways

Reactome:

Activation of Matrix Metalloproteinases

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONOTRUNCAL HEART MALFORMATIONS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTINODULAR GOITER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Alzheimer Disease	Associate	32854783	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia Lymphoma Adult T Cell	Associate	19144404	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	25575966	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	37563543	★☆☆☆☆ Found in Text Mining only