TAS2R13 (taste 2 receptor member 13)

Gene

• Entrez ID: 50838
• Gene name: Taste 2 receptor member 13
• Gene symbol: TAS2R13
• Synonyms (NCBI Gene): T2R13, TRB3
• Chromosome: 12
• Chromosome location: 12p13.2
• Summary: This gene product belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia. They are organiz

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030285	hsa-miR-26b-5p	Microarray	19088304

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IBA
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IDA	20022913
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0008527	Function	Taste receptor activity	TAS	10761934
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IC	20022913
GO:0016020	Component	Membrane	IEA
GO:0032467	Process	Positive regulation of cytokinesis	IMP	22888021
GO:0033038	Function	Bitter taste receptor activity	IBA
GO:0033038	Function	Bitter taste receptor activity	IDA	20022913
GO:0033038	Function	Bitter taste receptor activity	IEA
GO:0050909	Process	Sensory perception of taste	IEA

Other IDs

• MIM: 604792
• HGNC: 14919
• e!Ensembl: ENSG00000212128

Protein

• UniProt ID: Q9NYV9
• Protein name: Taste receptor type 2 member 13 (T2R13) (Taste receptor family B member 3) (TRB3)
• Protein function: Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05296	TAS2R	1 → 300	Taste receptor protein (TAS2R)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells.
• Sequence:

  MESALPSIFTLVIIAEFIIGNLSNGFIVLINCIDWVSKRELSSVDKLLIILAISRIGLIW
  EILVSWFLALHYLAIFVSGTGLRIMIFSWIVSNHFNLWLATIFSIFYLLKIASFSSPAFL
  YLKWRVNKVILMILLGTLVFLFLNLIQINMHIKDWLDRYERNTTWNFSMSDFETFSVSVK
  FTMTMFSLTPFTVAFISFLLLIFSLQKHLQKMQLNYKGHRDPRTKVHTNALKIVISFLLF
  YASFFLCVLISWISELYQNTVIYMLCETIGVFSPSSHSFLLILGNAKLRQAFLLVAAKVW
  AKR

• Sequence length: 303

Pathways

KEGG:

Taste transduction

Reactome:

G alpha (i) signalling events
Class C/3 (Metabotropic glutamate/pheromone receptors)