Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	50838
Gene name Gene Name - the full gene name approved by the HGNC.	Taste 2 receptor member 13
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TAS2R13
Synonyms (NCBI Gene) Gene synonyms aliases	T2R13, TRB3
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12p13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene product belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia. They are organiz

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030285	hsa-miR-26b-5p	Microarray	19088304

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IBA
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IDA	20022913
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0008527	Function	Taste receptor activity	TAS	10761934
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IC	20022913
GO:0016020	Component	Membrane	IEA
GO:0032467	Process	Positive regulation of cytokinesis	IMP	22888021
GO:0033038	Function	Bitter taste receptor activity	IBA
GO:0033038	Function	Bitter taste receptor activity	IDA	20022913
GO:0033038	Function	Bitter taste receptor activity	IEA
GO:0050909	Process	Sensory perception of taste	IEA

MIM	HGNC	e!Ensembl
604792	14919	ENSG00000212128

Protein

UniProt ID

Q9NYV9

Protein name

Taste receptor type 2 member 13 (T2R13) (Taste receptor family B member 3) (TRB3)

Protein function

Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05296	TAS2R	1 → 300	Taste receptor protein (TAS2R)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells.

Sequence

MESALPSIFTLVIIAEFIIGNLSNGFIVLINCIDWVSKRELSSVDKLLIILAISRIGLIW
EILVSWFLALHYLAIFVSGTGLRIMIFSWIVSNHFNLWLATIFSIFYLLKIASFSSPAFL
YLKWRVNKVILMILLGTLVFLFLNLIQINMHIKDWLDRYERNTTWNFSMSDFETFSVSVK
FTMTMFSLTPFTVAFISFLLLIFSLQKHLQKMQLNYKGHRDPRTKVHTNALKIVISFLLF
YASFFLCVLISWISELYQNTVIYMLCETIGVFSPSSHSFLLILGNAKLRQAFLLVAAKVW
AKR

Sequence length

303

Interactions

View interactions

	KEGG		Reactome
	Taste transduction		G alpha (i) signalling events Class C/3 (Metabotropic glutamate/pheromone receptors)

TAS2R13 (taste 2 receptor member 13)