Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5083
Gene name Gene Name - the full gene name approved by the HGNC.
Paired box 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PAX9
Synonyms (NCBI Gene) Gene synonyms aliases
STHAG3
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and c
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1594475481 ->C Pathogenic Frameshift variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT555831 hsa-miR-92b-3p PAR-CLIP 21572407
MIRT555830 hsa-miR-363-3p PAR-CLIP 21572407
MIRT555829 hsa-miR-32-5p PAR-CLIP 21572407
MIRT555828 hsa-miR-25-3p PAR-CLIP 21572407
MIRT555827 hsa-miR-367-3p PAR-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
167416 8623 ENSG00000198807
Protein
UniProt ID P55771
Protein name Paired box protein Pax-9
Protein function Transcription factor required for normal development of thymus, parathyroid glands, ultimobranchial bodies, teeth, skeletal elements of skull and larynx as well as distal limbs.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00292 PAX 4 128 Domain
Sequence
MEPAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARY
NETGSILPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSV
SSISRILR
NKIGNLAQQGHYDSYKQHQPTPQPALPYNHIYSYPSPITAAAAKVPTPPGVP
AIPGSVAMPRTWPSSHSVTDILGIRSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHA
VNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGH
GWQHAGGTSLSPHNCDIPASLAFKGMQAAREGSHSVTASAL
Sequence length 341
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
tooth agenesis tooth agenesis, selective, 3 rs1594475481, rs2139106532, rs2139108874, rs121917720, rs587776350, rs1881345182, rs1555316697, rs104894467, rs1131692057, rs28933970, rs745522921, rs2139108031, rs28933971, rs28933972 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast cancer Breast cancer N/A N/A GWAS
Prostate cancer Prostate cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Missed Associate 35897718
Adenocarcinoma Associate 30670912
Amelogenesis imperfecta local hypoplastic form Associate 28910570
Anodontia Associate 12605438, 16498076, 18701815, 18790474, 21111400, 23227268, 23549991, 23718693, 23857653, 24160254, 24631698, 25101640, 27665865, 28910570, 29893310
View all (7 more)
Breast Neoplasms Associate 29727689, 34889888
Carcinogenesis Associate 24631698
Carcinoma Squamous Cell Associate 38115305
Cleft Lip Associate 34684112
Cleft Palate Associate 31609978, 34684112
Conversion Disorder Associate 36017684, 39304502